Searching for night : 127 results found | RSS Feed for this search

1 2 3 4 5

21L.463 Renaissance Literature (MIT) 21L.463 Renaissance Literature (MIT)

Description

The Renaissance has justly become both famous and notorious as an age of discovery, and its voyages took place in many realms. This semester, we will read several history making narratives of early modern travel: first-hand accounts of discovery, captivity, conquest, or cultural encounter. As Europeans came to acquire experience of unfamiliar places, literary texts of the period began to assimilate this experience by describing imagined voyages across real or fantastic landscapes. Finally, voyages of exploration served Renaissance writers as a metaphor: for intellectual inquiry, for spiritual development, or for the pursuit of love. Among the literary genres sampled this semester will be sonnets, plays, prose narratives, utopias, and chivalric romance. Authors and travellers will include F The Renaissance has justly become both famous and notorious as an age of discovery, and its voyages took place in many realms. This semester, we will read several history making narratives of early modern travel: first-hand accounts of discovery, captivity, conquest, or cultural encounter. As Europeans came to acquire experience of unfamiliar places, literary texts of the period began to assimilate this experience by describing imagined voyages across real or fantastic landscapes. Finally, voyages of exploration served Renaissance writers as a metaphor: for intellectual inquiry, for spiritual development, or for the pursuit of love. Among the literary genres sampled this semester will be sonnets, plays, prose narratives, utopias, and chivalric romance. Authors and travellers will include F

Subjects

Renaissance | Renaissance | literature | literature | Middle Ages | Middle Ages | Professor Vinaver | Professor Vinaver | Middle English | Middle English | Primum Mobile | Primum Mobile | House of Busirane | House of Busirane | Sawles Warde | Sawles Warde | Natalis Comes | Natalis Comes | Unmoved Mover | Unmoved Mover | Colin Clouts Come Home Againe | Colin Clouts Come Home Againe | Eniautos Daimon | Eniautos Daimon | Piers Plowman | Piers Plowman | Prince Arthur | Prince Arthur | Queen Elizabeth | Queen Elizabeth | Round Table | Round Table | Sir Orfeo | Sir Orfeo | heauy plight | heauy plight | neuer wight | neuer wight | knight aliue | knight aliue | wyld man | wyld man | liuing wight | liuing wight | first aduenture | first aduenture | lining wight | lining wight | more increast | more increast | straunger knight | straunger knight | vncouth sight | vncouth sight | vtmost date | vtmost date | saluage man | saluage man | euerlasting fame | euerlasting fame | euill plight | euill plight | straunge aduentures | straunge aduentures | haue rent | haue rent | deare besought | deare besought | nigh approcht | nigh approcht | euery ioynt | euery ioynt | yron man | yron man | braue knights | braue knights | faire damzell | faire damzell | forrest wyde | forrest wyde | euery vaine | euery vaine | heauens hight | heauens hight | Sir Guyon | Sir Guyon | Sir Calidore | Sir Calidore | Sir Satyrane | Sir Satyrane | Briton Prince | Briton Prince | Faerie Queene | Faerie Queene | Sir Calepine | Sir Calepine | Squire of Dames | Squire of Dames | Sir Paridell | Sir Paridell | Saint George | Saint George | Sir Triamond | Sir Triamond | Which Cambell | Which Cambell | Whom Calidore. | Whom Calidore.

License

Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see http://ocw.mit.edu/terms/index.htm

Site sourced from

http://ocw.mit.edu/rss/all/mit-allcourses.xml

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

X-15 pilots clown around X-15 pilots clown around

Description

Subjects

airplane | airplane | mckay | mckay | aircraft | aircraft | aviation | aviation | dana | dana | nasa | nasa | knight | knight | engel | engel | usaf | usaf | thompson | thompson | aerospace | aerospace | usairforce | usairforce | xplane | xplane | spaceflight | spaceflight | x15 | x15 | unitedstatesairforce | unitedstatesairforce | rushworth | rushworth | thiokol | thiokol | billdana | billdana | naa | naa | nationalaeronauticsandspaceadministration | nationalaeronauticsandspaceadministration | rocketplane | rocketplane | joeengel | joeengel | northamericanaviation | northamericanaviation | mannedspaceflight | mannedspaceflight | northamericanx15 | northamericanx15 | miltthompson | miltthompson | xlr99 | xlr99 | josephengle | josephengle | experimentalflight | experimentalflight | jackmckay | jackmckay | x15a2 | x15a2 | x15a | x15a | 566671 | 566671 | williamdana | williamdana | reactionmotors | reactionmotors | reactionmotorsxlr99 | reactionmotorsxlr99 | af566671 | af566671 | usaf566671 | usaf566671 | robertrushworth | robertrushworth | williampeteknight | williampeteknight | peteknight | peteknight | miltonthompson | miltonthompson

License

No known copyright restrictions

Site sourced from

http://api.flickr.com/services/feeds/photos_public.gne?id=44494372@N05&lang=en-us&format=rss_200

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

21L.707 Arthurian Literature and Celtic Colonization (MIT) 21L.707 Arthurian Literature and Celtic Colonization (MIT)

Description

The course examines the earliest emergence of stories about King Arthur and the Knights of the Round Table in the context of the first wave of British Imperialism and the expanded powers of the Catholic Church during the twelfth and thirteenth centuries. The morphology of Arthurian romance will be set off against original historical documents and chronicle sources for the English conquests in Brittany, Wales, Scotland, and Ireland to understand the ways in which these new attitudes towards Empire were being mythologized. Authors will include Bede, Geoffrey of Monmouth, Chrétien de Troyes, Marie de France, Gerald of Wales, together with some lesser known works like the Perilous Graveyard, the Knight with the Sword, and Perlesvaus, or the High History of the Holy Graal. Special attenti The course examines the earliest emergence of stories about King Arthur and the Knights of the Round Table in the context of the first wave of British Imperialism and the expanded powers of the Catholic Church during the twelfth and thirteenth centuries. The morphology of Arthurian romance will be set off against original historical documents and chronicle sources for the English conquests in Brittany, Wales, Scotland, and Ireland to understand the ways in which these new attitudes towards Empire were being mythologized. Authors will include Bede, Geoffrey of Monmouth, Chrétien de Troyes, Marie de France, Gerald of Wales, together with some lesser known works like the Perilous Graveyard, the Knight with the Sword, and Perlesvaus, or the High History of the Holy Graal. Special attenti

Subjects

Literature | Literature | celtic | celtic | colonization | colonization | King Arthur | King Arthur | Knights of the Round Table | Knights of the Round Table | British Imperialism | British Imperialism | Catholic Church | Catholic Church | twelfth century | twelfth century | thirteenth century | thirteenth century | morphology | morphology | Arthurian romance | Arthurian romance | historical documents | historical documents | English conquests | English conquests | Brittany | Brittany | Wales | Wales | Scotland | Scotland | Ireland | Ireland | Bede | Bede | Geoffrey of Monmouth | Geoffrey of Monmouth | Chr?tien de Troyes | Chr?tien de Troyes | Marie de France | Marie de France | Gerald of Wales | Gerald of Wales | Perilous Graveyard | Perilous Graveyard | Knight of the Sword | Knight of the Sword | Perlesvaus | Perlesvaus | High History of the Holy Graal | High History of the Holy Graal

License

Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see http://ocw.mit.edu/terms/index.htm

Site sourced from

http://ocw.mit.edu/rss/all/mit-allcourses.xml

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

X-15 Pilots X-15 Pilots

Description

Subjects

armstrong | armstrong | afrc | afrc | nasaarmstrong | nasaarmstrong | northamericanaviationx15josephenglejoeenglerobertrushworthjohnmckayjackmckaywilliamknightpeteknightmiltonthompsonmiltthompsonbilldananasaflightresearchcenter | northamericanaviationx15josephenglejoeenglerobertrushworthjohnmckayjackmckaywilliamknightpeteknightmiltonthompsonmiltthompsonbilldananasaflightresearchcenter

License

No known copyright restrictions

Site sourced from

http://api.flickr.com/services/feeds/photos_public.gne?id=44494372@N05&lang=en-us&format=rss_200

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

11.139 The City in Film (MIT) 11.139 The City in Film (MIT)

Description

Using film as a lens to explore and interpret various aspects of the urban experience in both the U.S. and abroad, this course presents a survey of important developments in urbanism from 1900 to the present day, including changes in technology, bureaucracy, and industrialization; immigration and national identity; race, class, gender, and economic inequality; politics, conformity, and urban anomie; and planning, development, private property, displacement, sprawl, environmental degradation, and suburbanization. Using film as a lens to explore and interpret various aspects of the urban experience in both the U.S. and abroad, this course presents a survey of important developments in urbanism from 1900 to the present day, including changes in technology, bureaucracy, and industrialization; immigration and national identity; race, class, gender, and economic inequality; politics, conformity, and urban anomie; and planning, development, private property, displacement, sprawl, environmental degradation, and suburbanization.

Subjects

cities | cities | urban | urban | urban experience | urban experience | urbanism | urbanism | development | development | technology | technology | bureaucracy | bureaucracy | industrialization | industrialization | immigration | immigration | national identity | national identity | race | race | class | class | gender | gender | economic inequality | economic inequality | politics | politics | conformity | conformity | urban anomie | urban anomie | planning | planning | private property | private property | displacement | displacement | sprawl | sprawl | environmental degradation | environmental degradation | suburbanization | suburbanization | metropolis | metropolis | berlin symphony of a great city | berlin symphony of a great city | the crowd | the crowd | modern times | modern times | ladri di biciclette | ladri di biciclette | bicycle thieves | bicycle thieves | the naked city | the naked city | west side story | west side story | play time | play time | midnight cowboy | midnight cowboy | blade runner | blade runner | do the right thing | do the right thing | london | london | night on earth | night on earth

License

Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see http://ocw.mit.edu/terms/index.htm

Site sourced from

http://ocw.mit.edu/rss/all/mit-allcourses-11.xml

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

The cargo ship 'Armanistan' at night The cargo ship 'Armanistan' at night

Description

Subjects

light | light | sky | sky | industry | industry | night | night | stairs | stairs | interesting | interesting | construction | construction | industrial | industrial | ship | ship | darkness | darkness | crane | crane | mark | mark | label | label | debris | debris | grain | grain | platform | platform | rail | rail | ground | ground | vessel | vessel | cargo | cargo | structure | structure | number | number | company | company | deck | deck | nighttime | nighttime | bow | bow | porthole | porthole | letter | letter | unusual | unusual | hull | hull | launch | launch | shipyard | shipyard | southshields | southshields | development | development | partnership | partnership | fascinating | fascinating | digitalimage | digitalimage | 1865 | 1865 | berth | berth | artificiallight | artificiallight | shipbuilding | shipbuilding | launched | launched | cargoship | cargoship | blackandwhitephotograph | blackandwhitephotograph | lawe | lawe | northeastofengland | northeastofengland | maritimeheritage | maritimeheritage | sirjamesknott | sirjamesknott | november1948 | november1948 | johnreadhead | johnreadhead | stricklineltd | stricklineltd | strickline | strickline | princeline | princeline | britishshipbuilders | britishshipbuilders | hainsteamshipcompany | hainsteamshipcompany | armanistan | armanistan | johnreadheadsonsltd | johnreadheadsonsltd | johnreadheadsons | johnreadheadsons | highwestyard | highwestyard | johnreadheadsonssouthshields | johnreadheadsonssouthshields | jsoftley | jsoftley | swanhuntergroup | swanhuntergroup | 30november1948 | 30november1948 | johnreadheadco | johnreadheadco

License

No known copyright restrictions

Site sourced from

http://api.flickr.com/services/feeds/photos_public.gne?id=29295370@N07&lang=en-us&format=rss_200

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Bonfire Night for the children of Woodalls Newspapers staff (1506591)3 Bonfire Night for the children of Woodalls Newspapers staff (1506591)3

Description

Subjects

cymru | cymru | wales | wales | llyfrgellgenedlaetholcymru | llyfrgellgenedlaetholcymru | nationallibraryofwales | nationallibraryofwales | charlesgeoff19092002 | charlesgeoff19092002 | negyddffilm | negyddffilm | filmnegatives | filmnegatives | bonfire | bonfire | 1940s | 1940s | fireworksnight | fireworksnight | bonfirenight | bonfirenight | november5th | november5th | fireworks | fireworks | guyfoulkes | guyfoulkes

License

No known copyright restrictions

Site sourced from

http://api.flickr.com/services/feeds/photos_public.gne?id=37199428@N06&lang=en-us&format=rss_200

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

November Effigies

Description

From 'Street Life in London', 1877, by John Thomson and Adolphe Smith: "The accompanying photograph is that of a nondescript guy, somewhat clumsily built up by a costermonger who lives in the south-east of London. This meaningless monstrosity, together with the absurd appearance of the man in woman's clothes, amuses some persons, and the conductor of such an exhibition can hope to realize about thirty shillings the first day, a pound on the 6th of November, and ten or fifteen shillings on the 7th. With this money the cost of getting up the guy must be refunded, and a shilling or eighteen pence per day given to the boys who help to swell the cortege. The boys' share of the proceeds is consequently somewhat out of proportion with the time and cheers they devote to promoting the success of the enterprise; but it is argued that they enjoy the fun, while to their seniors the venture is attended with some risk, and is only considered as another form of labour for daily bread." For the full story, and other photographs and commentaries, follow this link and click through to the PDF file at the bottom of the description archives.lse.ac.uk/Record.aspx?src=CalmView.Catalog&i...

Subjects

streetlifeinlondon | november5th | guyfawkes | effigy | effigies | cart | donkey | crossdressing | guyfawkesnight | fireworknight | bonfirenight | london | streetperformance

License

No known copyright restrictions

Site sourced from

LSE Library | FlickR

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

21L.463 Renaissance Literature (MIT)

Description

The Renaissance has justly become both famous and notorious as an age of discovery, and its voyages took place in many realms. This semester, we will read several history making narratives of early modern travel: first-hand accounts of discovery, captivity, conquest, or cultural encounter. As Europeans came to acquire experience of unfamiliar places, literary texts of the period began to assimilate this experience by describing imagined voyages across real or fantastic landscapes. Finally, voyages of exploration served Renaissance writers as a metaphor: for intellectual inquiry, for spiritual development, or for the pursuit of love. Among the literary genres sampled this semester will be sonnets, plays, prose narratives, utopias, and chivalric romance. Authors and travellers will include F

Subjects

Renaissance | literature | Middle Ages | Professor Vinaver | Middle English | Primum Mobile | House of Busirane | Sawles Warde | Natalis Comes | Unmoved Mover | Colin Clouts Come Home Againe | Eniautos Daimon | Piers Plowman | Prince Arthur | Queen Elizabeth | Round Table | Sir Orfeo | heauy plight | neuer wight | knight aliue | wyld man | liuing wight | first aduenture | lining wight | more increast | straunger knight | vncouth sight | vtmost date | saluage man | euerlasting fame | euill plight | straunge aduentures | haue rent | deare besought | nigh approcht | euery ioynt | yron man | braue knights | faire damzell | forrest wyde | euery vaine | heauens hight | Sir Guyon | Sir Calidore | Sir Satyrane | Briton Prince | Faerie Queene | Sir Calepine | Squire of Dames | Sir Paridell | Saint George | Sir Triamond | Which Cambell | Whom Calidore.

License

Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see https://ocw.mit.edu/terms/index.htm

Site sourced from

https://ocw.mit.edu/rss/all/mit-allcourses.xml

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

A Florence Nightingale for the 21st Century

Description

From the 2010 Alumni Weekend. Marjorie Reeves Memorial lecture given in St Anne's College. Mark Bostridge, author of the first major biography of Florence Nightingale in 50 years talks about the great woman's life and character. Wales; http://creativecommons.org/licenses/by-nc-sa/2.0/uk/

Subjects

s college | nursing | crimean war | florence nightingale | alumni | 2010 | biography | s college | nursing | crimean war | florence nightingale | alumni | 2010 | biography | 2010-09-25

License

http://creativecommons.org/licenses/by-nc-sa/2.0/uk/

Site sourced from

http://mediapub.it.ox.ac.uk/feeds/129186/audio.xml

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

A Florence Nightingale for the 21st Century

Description

From the 2010 Alumni Weekend. Marjorie Reeves Memorial lecture given in St Anne's College. Mark Bostridge, author of the first major biography of Florence Nightingale in 50 years talks about the great woman's life and character. Wales; http://creativecommons.org/licenses/by-nc-sa/2.0/uk/

Subjects

s college | nursing | crimean war | florence nightingale | alumni | 2010 | biography | s college | nursing | crimean war | florence nightingale | alumni | 2010 | biography | 2010-09-25

License

http://creativecommons.org/licenses/by-nc-sa/2.0/uk/

Site sourced from

http://mediapub.it.ox.ac.uk/feeds/129186/video.xml

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

7.342 G-Protein Coupled Receptors: Vision and Disease (MIT) 7.342 G-Protein Coupled Receptors: Vision and Disease (MIT)

Description

How do we communicate with the outside world? How are our senses of vision, smell, taste and pain controlled at the cellular and molecular levels? What causes medical conditions like allergies, hypertension, depression, obesity and various central nervous system disorders? G-protein coupled receptors (GPCRs) provide a major part of the answer to all of these questions. GPCRs constitute the largest family of cell-surface receptors and in humans are encoded by more than 1,000 genes. GPCRs convert extracellular messages into intracellular responses and are involved in essentially all physiological processes. GPCR dysfunction results in numerous human disorders, and over 50% of all prescription drugs on the market today directly or indirectly target GPCRs. In this course, we will discuss GPCR How do we communicate with the outside world? How are our senses of vision, smell, taste and pain controlled at the cellular and molecular levels? What causes medical conditions like allergies, hypertension, depression, obesity and various central nervous system disorders? G-protein coupled receptors (GPCRs) provide a major part of the answer to all of these questions. GPCRs constitute the largest family of cell-surface receptors and in humans are encoded by more than 1,000 genes. GPCRs convert extracellular messages into intracellular responses and are involved in essentially all physiological processes. GPCR dysfunction results in numerous human disorders, and over 50% of all prescription drugs on the market today directly or indirectly target GPCRs. In this course, we will discuss GPCR

Subjects

allergies | allergies | hypertension | hypertension | depression | depression | obesity | obesity | central nervous system disorders | central nervous system disorders | G-protein coupled receptors | G-protein coupled receptors | GPCR | GPCR | cell-surface receptors | cell-surface receptors | George Wald | George Wald | vision | vision | chromophore | chromophore | transducin | transducin | metarhodopsin II | metarhodopsin II | homodimers | homodimers | heterodimers | heterodimers | retinitis pigmentosa | retinitis pigmentosa | night blindness | night blindness | Dopamine | Dopamine | antihistamines | antihistamines | Claviceps purpurea | Claviceps purpurea | Human chemokine receptor 5 | Human chemokine receptor 5 | CCR5 | CCR5 | HIV-1 | HIV-1 | CCR5-delta32 | CCR5-delta32 | Olfactory receptors | Olfactory receptors | Taste receptors | Taste receptors

License

Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see http://ocw.mit.edu/terms/index.htm

Site sourced from

http://ocw.mit.edu/rss/all/mit-allcourses-7.xml

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

21L.703 English Renaissance Drama: Theatre and Society in the Age of Shakespeare (MIT) 21L.703 English Renaissance Drama: Theatre and Society in the Age of Shakespeare (MIT)

Description

Shakespeare "doth bestride the narrow world" of the English Renaissance "like a colossus," leaving his contemporaries "walk under his large legs and peep about" to find themselves in "dishonourable graves." This course aims in part to correct this grave injustice by surveying the extraordinary output of playwrights whose names have largely been eclipsed by their more luminous compatriot: Marlowe, Jonson, Webster, and Ford, among others. Reading Shakespeare as just one of a group of practitioners -- many of whom were more popular than him during and even after his remarkable career -- will restore, I hope, a sense not just of the richness of English Renaissance drama, but also that of the historical and cultural moment of the English Renaissance itself. This course will examine the Shakespeare "doth bestride the narrow world" of the English Renaissance "like a colossus," leaving his contemporaries "walk under his large legs and peep about" to find themselves in "dishonourable graves." This course aims in part to correct this grave injustice by surveying the extraordinary output of playwrights whose names have largely been eclipsed by their more luminous compatriot: Marlowe, Jonson, Webster, and Ford, among others. Reading Shakespeare as just one of a group of practitioners -- many of whom were more popular than him during and even after his remarkable career -- will restore, I hope, a sense not just of the richness of English Renaissance drama, but also that of the historical and cultural moment of the English Renaissance itself. This course will examine the

Subjects

Shakespeare | Shakespeare | English Renaissance | English Renaissance | Marlowe | Marlowe | Jonson | Jonson | Webster | Webster | Ford | Ford | English Renaissance drama | English Renaissance drama | the relationship between theatre and society | the relationship between theatre and society | culture | culture | aesthetic | aesthetic | gender and class dynamics in Renaissance society | gender and class dynamics in Renaissance society | money | trade | and colonialism | money | trade | and colonialism | the body as metaphor and theatrical ?object? | the body as metaphor and theatrical ?object? | allegory and aesthetic form | allegory and aesthetic form | theatricality and meta-theatricality | theatricality and meta-theatricality | the private and the public | the private and the public | allegory | allegory | aesthetic form | aesthetic form | drama | drama | gender dynamics | gender dynamics | class dynamics | class dynamics | private | private | public | public | theatrically | theatrically | meta-theatrically | meta-theatrically | money | money | trade | trade | colonialism | colonialism | body | body | metaphor | metaphor | theatre | theatre | society | society | Spanish tragedy | Spanish tragedy | Hamlet | Hamlet | Jew of Malta | Jew of Malta | Alchemist | Alchemist | Duchess of Malfi | Duchess of Malfi | Broken Heart | Broken Heart | Arden of Faversham | Arden of Faversham | Witch of Edmonton | Witch of Edmonton | Knight of the Burning Pestle | Knight of the Burning Pestle | Island Princess | Island Princess

License

Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see http://ocw.mit.edu/terms/index.htm

Site sourced from

http://ocw.mit.edu/rss/all/mit-allcourses.xml

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

SP.322 Prohibition and Permission (MIT) SP.322 Prohibition and Permission (MIT)

Description

Explore where the prohibitions and permissions that occur in every day life come from, why they exist, and what gives them force. For example: food—you are only willing and able to eat a subset of the world's edible substances. Marriage—some marriages are prohibited by law or by custom. This course addresses questions of prohibition and permission using psychological sources and literary works from ancient to modern. Texts include works by Shakespeare, Melville, Mary Rowlandson, and Anita Desai. Students give group and individual oral presentations. Explore where the prohibitions and permissions that occur in every day life come from, why they exist, and what gives them force. For example: food—you are only willing and able to eat a subset of the world's edible substances. Marriage—some marriages are prohibited by law or by custom. This course addresses questions of prohibition and permission using psychological sources and literary works from ancient to modern. Texts include works by Shakespeare, Melville, Mary Rowlandson, and Anita Desai. Students give group and individual oral presentations.

Subjects

eating | eating | disgust | disgust | bible | bible | mary rowlandson | mary rowlandson | shakespeare | shakespeare | twelfth night | twelfth night | melville | melville | typee | typee | kafka | kafka | dietary laws | dietary laws | fasting | fasting | feasting | feasting | gender | gender | family | family | sanction | sanction | permission | permission | culture | culture | food | food | social practices | social practices | metamorphosis | metamorphosis

License

Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see http://ocw.mit.edu/terms/index.htm

Site sourced from

http://ocw.mit.edu/rss/all/mit-allcourses.xml

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Twelfe Night, Or what you will. (eBook)

Description

ePub version of text Twelfe Night, Or what you will. / Shakespeare, William, 1564-1616. Wales; http://creativecommons.org/licenses/by-nc-sa/2.0/uk/

Subjects

playwright | england | 16th century | ota | twelfth night | Plays | oxford text archive | playwright | england | 16th century | ota | twelfth night | Plays | oxford text archive

License

http://creativecommons.org/licenses/by-nc-sa/2.0/uk/

Site sourced from

http://mediapub.it.ox.ac.uk/feeds/129172/document.xml

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Gifts for Men

Description

This photograph is from the Robert Sanderson collection. which was kindly donated to Tyne & Wear Archives & Museums. This is a men?s gift display in Binns department store, Newcastle upon Tyne. This is a 35mm slide. It was taken in 1966. (Copyright) We're happy for you to share this digital image within the spirit of The Commons. Please cite 'Tyne & Wear Archives & Museums' when reusing. Certain restrictions on high quality reproductions and commercial use of the original physical version apply though; if you're unsure please email adam.bell@twmuseums.org.uk

Subjects

shopping | gifts | binns | christmas | festive | santa | display | nostalgic | gentlemansgifts | decorations | shopwindow | shopdummy | santahat | nightie | 1960s | shopfront | binnsdepartmentstore | tyne | newcastle | shoes | neckties | price | tags | pricetags | mensclothes | lights | sign | nightattire | shirt | jumper | trousers | gloves | underwear | glitter | colour | shallow

License

No known copyright restrictions

Site sourced from

Tyne & Wear Archives & Museums | FlickR

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Bainbridge festive windows

Description

This photograph is from the Robert Sanderson collection. which was kindly donated to Tyne & Wear Archives & Museums. This is a colourful display in Bainbridge?s department store, Newcastle upon Tyne. This is a 35mm slide. It was taken in 1965. (Copyright) We're happy for you to share this digital image within the spirit of The Commons. Please cite 'Tyne & Wear Archives & Museums' when reusing. Certain restrictions on high quality reproductions and commercial use of the original physical version apply though; if you're unsure please email adam.bell@twmuseums.org.uk

Subjects

magical | windowdressing | decorations | illumination | shopwindow | shopdisplay | sixties | lamps | christmaslights | festive | seasonal | christmas | lights | colourphotograph | 1960schristmasshopfronts | glitter | window | wall | glass | retail | consumerism | digitalimage | northeastofengland | unitedkingdom | fascinating | interesting | unusual | bainbridgefestivewindows | colourfuldisplay | display | bainbridge?sdepartmentstore | streetscene | business | premises | 35mmslide | newcastleupontyne | 1965 | festiveseason | women | coat | hat | bag | handle | pavement | pedestrian | cabinet | objects | flowers | vase | plate | shade | light | cord | arch | box | legs | timber | kettle | container | ornament | artificiallight | nighttime | night | petal | mark | paint | shine | compelling | neutralbackground | ceiling | glasses | standing | gathering | colourful | socialhistory

License

No known copyright restrictions

Site sourced from

Tyne & Wear Archives & Museums | FlickR

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Hedwig Michel with Night-Blooming Cereus and Snake Vine

Description

Subjects

palms | women | florida | president | parks | catus | estero | floraandfauna | leecounty | sabal | historicsites | hibbertia | nightbloomingcereus | treesandplants | koreshanunity | floridaparkservice | hylocereustricostatus | stateparksandreserves | nightfloweringplants | michelhedwig | koreshanstatehistoricsitepark

License

No known copyright restrictions

Site sourced from

http://api.flickr.com/services/feeds/photos_public.gne?id=31846825@N04&lang=en-us&format=rss_200

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Trains at station, Valentia Harbour, Co. Kerry Trains at station, Valentia Harbour, Co. Kerry

Description

Subjects

ireland | ireland | station | station | train | train | railway | railway | lastday | lastday | rails | rails | locomotive | locomotive | trucks | trucks | 1956 | 1956 | munster | munster | closure | closure | thepoint | thepoint | royalhotel | royalhotel | 1430 | 1430 | valentia | valentia | cokerry | cokerry | knightstown | knightstown | c201 | c201 | nationallibraryofireland | nationallibraryofireland | 201class | 201class | michaelmckenna | michaelmckenna | renardpoint | renardpoint | jamespo’dea | jamespo’dea | o’deaphotographiccollection | o’deaphotographiccollection | farranforetovalentiaharbour | farranforetovalentiaharbour | bombdamaged1973 | bombdamaged1973 | meighlevelcrossing | meighlevelcrossing | january30th1960 | january30th1960 | destroyedbybomb | destroyedbybomb | caherciveenclosure | caherciveenclosure | farranforeflyer | farranforeflyer

License

No known copyright restrictions

Site sourced from

http://api.flickr.com/services/feeds/photos_public.gne?id=47290943@N03&lang=en-us&format=rss_200

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

CC.S10 Prohibition and Permission (MIT) CC.S10 Prohibition and Permission (MIT)

Description

Explore where the prohibitions and permissions that occur in every day life come from, why they exist, and what gives them force. For example: food—you are only willing and able to eat a subset of the world's edible substances. Marriage—some marriages are prohibited by law or by custom. This course addresses questions of prohibition and permission using psychological sources and literary works from ancient to modern. Texts include works by Shakespeare, Melville, Mary Rowlandson, and Anita Desai. Students give group and individual oral presentations. Explore where the prohibitions and permissions that occur in every day life come from, why they exist, and what gives them force. For example: food—you are only willing and able to eat a subset of the world's edible substances. Marriage—some marriages are prohibited by law or by custom. This course addresses questions of prohibition and permission using psychological sources and literary works from ancient to modern. Texts include works by Shakespeare, Melville, Mary Rowlandson, and Anita Desai. Students give group and individual oral presentations.

Subjects

eating | eating | disgust | disgust | bible | bible | mary rowlandson | mary rowlandson | shakespeare | shakespeare | twelfth night | twelfth night | melville | melville | typee | typee | kafka | kafka | dietary laws | dietary laws | fasting | fasting | feasting | feasting | gender | gender | family | family | sanction | sanction | permission | permission | culture | culture | food | food | social practices | social practices | metamorphosis | metamorphosis

License

Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see http://ocw.mit.edu/terms/index.htm

Site sourced from

http://ocw.mit.edu/rss/all/mit-allcourses.xml

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Bear cub with Betsy Knight - Blountstown Bear cub with Betsy Knight - Blountstown

Description

Subjects

florida | florida | bears | bears | bearcub | bearcub | blountstown | blountstown | betsyknight | betsyknight

License

No known copyright restrictions

Site sourced from

http://api.flickr.com/services/feeds/photos_public.gne?id=31846825@N04&lang=en-us&format=rss_200

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

H Green Stamps store - Tallahassee H Green Stamps store - Tallahassee

Description

Subjects

signs | signs | night | night | florida | florida | tallahassee | tallahassee | stores | stores | retailstores | retailstores | shgreenstamps | shgreenstamps

License

No known copyright restrictions

Site sourced from

http://api.flickr.com/services/feeds/photos_public.gne?id=31846825@N04&lang=en-us&format=rss_200

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Printed Map Descriptive of London Poverty 1898-1899. Sheet 7. Inner Western District Printed Map Descriptive of London Poverty 1898-1899. Sheet 7. Inner Western District

Description

Subjects

poverty | poverty | london | london | westminster | westminster | booth | booth | chelsea | chelsea | map | map | victorian | victorian | charles | charles | knightsbridge | knightsbridge | cartography | cartography | paddington | paddington | kensington | kensington | mayfair | mayfair | nottinghill | nottinghill | pimlico | pimlico | bayswater | bayswater | brompton | brompton | marylebone | marylebone | charlesbooth | charlesbooth | belgravia | belgravia | lselibrary | lselibrary

License

No known copyright restrictions

Site sourced from

http://api.flickr.com/services/feeds/photos_public.gne?id=35128489@N07&lang=en-us&format=rss_200

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Amusement rides at the North Florida Fair - Tallahassee Amusement rides at the North Florida Fair - Tallahassee

Description

Subjects

night | night | florida | florida | fairs | fairs | tallahassee | tallahassee | amusementrides | amusementrides

License

No known copyright restrictions

Site sourced from

http://api.flickr.com/services/feeds/photos_public.gne?id=31846825@N04&lang=en-us&format=rss_200

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Cromaboo bridge, first stone laid in 1796, Athy, Co. Kildare. Cromaboo bridge, first stone laid in 1796, Athy, Co. Kildare.

Description

Subjects

bridge | bridge | plaque | plaque | coatofarms | coatofarms | athy | athy | countykildare | countykildare | johnroberts | johnroberts | mastermason | mastermason | nationallibraryofireland | nationallibraryofireland | williamfitzgerald | williamfitzgerald | jamesdelahunty | jamesdelahunty | dukeofleinster | dukeofleinster | cromaboo | cromaboo | jamespo’dea | jamespo’dea | o’deaphotographiccollection | o’deaphotographiccollection | knightofthetrowel | knightofthetrowel | cromabú | cromabú | yousaycontracterisay | yousaycontracterisay | jamesdelehunty | jamesdelehunty

License

No known copyright restrictions

Site sourced from

http://api.flickr.com/services/feeds/photos_public.gne?id=47290943@N03&lang=en-us&format=rss_200

Attribution

Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata