Searching for v : 76369 results found | RSS Feed for this search

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000 1001 1002 1003 1004 1005 1006 1007 1008 1009 1010 1011 1012 1013 1014 1015 1016 1017 1018 1019 1020 1021 1022 1023 1024 1025 1026 1027 1028 1029 1030 1031 1032 1033 1034 1035 1036 1037 1038 1039 1040 1041 1042 1043 1044 1045 1046 1047 1048 1049 1050 1051 1052 1053 1054 1055 1056 1057 1058 1059 1060 1061 1062 1063 1064 1065 1066 1067 1068 1069 1070 1071 1072 1073 1074 1075 1076 1077 1078 1079 1080 1081 1082 1083 1084 1085 1086 1087 1088 1089 1090 1091 1092 1093 1094 1095 1096 1097 1098 1099 1100 1101 1102 1103 1104 1105 1106 1107 1108 1109 1110 1111 1112 1113 1114 1115 1116 1117 1118 1119 1120 1121 1122 1123 1124 1125 1126 1127 1128 1129 1130 1131 1132 1133 1134 1135 1136 1137 1138 1139 1140 1141 1142 1143 1144 1145 1146 1147 1148 1149 1150 1151 1152 1153 1154 1155 1156 1157 1158 1159 1160 1161 1162 1163 1164 1165 1166 1167 1168 1169 1170 1171 1172 1173 1174 1175 1176 1177 1178 1179 1180 1181 1182 1183 1184 1185 1186 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201 1202 1203 1204 1205 1206 1207 1208 1209 1210 1211 1212 1213 1214 1215 1216 1217 1218 1219 1220 1221 1222 1223 1224 1225 1226 1227 1228 1229 1230 1231 1232 1233 1234 1235 1236 1237 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283 1284 1285 1286 1287 1288 1289 1290 1291 1292 1293 1294 1295 1296 1297 1298 1299 1300 1301 1302 1303 1304 1305 1306 1307 1308 1309 1310 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 1323 1324 1325 1326 1327 1328 1329 1330 1331 1332 1333 1334 1335 1336 1337 1338 1339 1340 1341 1342 1343 1344 1345 1346 1347 1348 1349 1350 1351 1352 1353 1354 1355 1356 1357 1358 1359 1360 1361 1362 1363 1364 1365 1366 1367 1368 1369 1370 1371 1372 1373 1374 1375 1376 1377 1378 1379 1380 1381 1382 1383 1384 1385 1386 1387 1388 1389 1390 1391 1392 1393 1394 1395 1396 1397 1398 1399 1400 1401 1402 1403 1404 1405 1406 1407 1408 1409 1410 1411 1412 1413 1414 1415 1416 1417 1418 1419 1420 1421 1422 1423 1424 1425 1426 1427 1428 1429 1430 1431 1432 1433 1434 1435 1436 1437 1438 1439 1440 1441 1442 1443 1444 1445 1446 1447 1448 1449 1450 1451 1452 1453 1454 1455 1456 1457 1458 1459 1460 1461 1462 1463 1464 1465 1466 1467 1468 1469 1470 1471 1472 1473 1474 1475 1476 1477 1478 1479 1480 1481 1482 1483 1484 1485 1486 1487 1488 1489 1490 1491 1492 1493 1494 1495 1496 1497 1498 1499 1500 1501 1502 1503 1504 1505 1506 1507 1508 1509 1510 1511 1512 1513 1514 1515 1516 1517 1518 1519 1520 1521 1522 1523 1524 1525 1526 1527 1528 1529 1530 1531 1532 1533 1534 1535 1536 1537 1538 1539 1540 1541 1542 1543 1544 1545 1546 1547 1548 1549 1550 1551 1552 1553 1554 1555 1556 1557 1558 1559 1560 1561 1562 1563 1564 1565 1566 1567 1568 1569 1570 1571 1572 1573 1574 1575 1576 1577 1578 1579 1580 1581 1582 1583 1584 1585 1586 1587 1588 1589 1590 1591 1592 1593 1594 1595 1596 1597 1598 1599 1600 1601 1602 1603 1604 1605 1606 1607 1608 1609 1610 1611 1612 1613 1614 1615 1616 1617 1618 1619 1620 1621 1622 1623 1624 1625 1626 1627 1628 1629 1630 1631 1632 1633 1634 1635 1636 1637 1638 1639 1640 1641 1642 1643 1644 1645 1646 1647 1648 1649 1650 1651 1652 1653 1654 1655 1656 1657 1658 1659 1660 1661 1662 1663 1664 1665 1666 1667 1668 1669 1670 1671 1672 1673 1674 1675 1676 1677 1678 1679 1680 1681 1682 1683 1684 1685 1686 1687 1688 1689 1690 1691 1692 1693 1694 1695 1696 1697 1698 1699 1700 1701 1702 1703 1704 1705 1706 1707 1708 1709 1710 1711 1712 1713 1714 1715 1716 1717 1718 1719 1720 1721 1722 1723 1724 1725 1726 1727 1728 1729 1730 1731 1732 1733 1734 1735 1736 1737 1738 1739 1740 1741 1742 1743 1744 1745 1746 1747 1748 1749 1750 1751 1752 1753 1754 1755 1756 1757 1758 1759 1760 1761 1762 1763 1764 1765 1766 1767 1768 1769 1770 1771 1772 1773 1774 1775 1776 1777 1778 1779 1780 1781 1782 1783 1784 1785 1786 1787 1788 1789 1790 1791 1792 1793 1794 1795 1796 1797 1798 1799 1800 1801 1802 1803 1804 1805 1806 1807 1808 1809 1810 1811 1812 1813 1814 1815 1816 1817 1818 1819 1820 1821 1822 1823 1824 1825 1826 1827 1828 1829 1830 1831 1832 1833 1834 1835 1836 1837 1838 1839 1840 1841 1842 1843 1844 1845 1846 1847 1848 1849 1850 1851 1852 1853 1854 1855 1856 1857 1858 1859 1860 1861 1862 1863 1864 1865 1866 1867 1868 1869 1870 1871 1872 1873 1874 1875 1876 1877 1878 1879 1880 1881 1882 1883 1884 1885 1886 1887 1888 1889 1890 1891 1892 1893 1894 1895 1896 1897 1898 1899 1900 1901 1902 1903 1904 1905 1906 1907 1908 1909 1910 1911 1912 1913 1914 1915 1916 1917 1918 1919 1920 1921 1922 1923 1924 1925 1926 1927 1928 1929 1930 1931 1932 1933 1934 1935 1936 1937 1938 1939 1940 1941 1942 1943 1944 1945 1946 1947 1948 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 2046 2047 2048 2049 2050 2051 2052 2053 2054 2055 2056 2057 2058 2059 2060 2061 2062 2063 2064 2065 2066 2067 2068 2069 2070 2071 2072 2073 2074 2075 2076 2077 2078 2079 2080 2081 2082 2083 2084 2085 2086 2087 2088 2089 2090 2091 2092 2093 2094 2095 2096 2097 2098 2099 2100 2101 2102 2103 2104 2105 2106 2107 2108 2109 2110 2111 2112 2113 2114 2115 2116 2117 2118 2119 2120 2121 2122 2123 2124 2125 2126 2127 2128 2129 2130 2131 2132 2133 2134 2135 2136 2137 2138 2139 2140 2141 2142 2143 2144 2145 2146 2147 2148 2149 2150 2151 2152 2153 2154 2155 2156 2157 2158 2159 2160 2161 2162 2163 2164 2165 2166 2167 2168 2169 2170 2171 2172 2173 2174 2175 2176 2177 2178 2179 2180 2181 2182 2183 2184 2185 2186 2187 2188 2189 2190 2191 2192 2193 2194 2195 2196 2197 2198 2199 2200 2201 2202 2203 2204 2205 2206 2207 2208 2209 2210 2211 2212 2213 2214 2215 2216 2217 2218 2219 2220 2221 2222 2223 2224 2225 2226 2227 2228 2229 2230 2231 2232 2233 2234 2235 2236 2237 2238 2239 2240 2241 2242 2243 2244 2245 2246 2247 2248 2249 2250 2251 2252 2253 2254 2255 2256 2257 2258 2259 2260 2261 2262 2263 2264 2265 2266 2267 2268 2269 2270 2271 2272 2273 2274 2275 2276 2277 2278 2279 2280 2281 2282 2283 2284 2285 2286 2287 2288 2289 2290 2291 2292 2293 2294 2295 2296 2297 2298 2299 2300 2301 2302 2303 2304 2305 2306 2307 2308 2309 2310 2311 2312 2313 2314 2315 2316 2317 2318 2319 2320 2321 2322 2323 2324 2325 2326 2327 2328 2329 2330 2331 2332 2333 2334 2335 2336 2337 2338 2339 2340 2341 2342 2343 2344 2345 2346 2347 2348 2349 2350 2351 2352 2353 2354 2355 2356 2357 2358 2359 2360 2361 2362 2363 2364 2365 2366 2367 2368 2369 2370 2371 2372 2373 2374 2375 2376 2377 2378 2379 2380 2381 2382 2383 2384 2385 2386 2387 2388 2389 2390 2391 2392 2393 2394 2395 2396 2397 2398 2399 2400 2401 2402 2403 2404 2405 2406 2407 2408 2409 2410 2411 2412 2413 2414 2415 2416 2417 2418 2419 2420 2421 2422 2423 2424 2425 2426 2427 2428 2429 2430 2431 2432 2433 2434 2435 2436 2437 2438 2439 2440 2441 2442 2443 2444 2445 2446 2447 2448 2449 2450 2451 2452 2453 2454 2455 2456 2457 2458 2459 2460 2461 2462 2463 2464 2465 2466 2467 2468 2469 2470 2471 2472 2473 2474 2475 2476 2477 2478 2479 2480 2481 2482 2483 2484 2485 2486 2487 2488 2489 2490 2491 2492 2493 2494 2495 2496 2497 2498 2499 2500 2501 2502 2503 2504 2505 2506 2507 2508 2509 2510 2511 2512 2513 2514 2515 2516 2517 2518 2519 2520 2521 2522 2523 2524 2525 2526 2527 2528 2529 2530 2531 2532 2533 2534 2535 2536 2537 2538 2539 2540 2541 2542 2543 2544 2545 2546 2547 2548 2549 2550 2551 2552 2553 2554 2555 2556 2557 2558 2559 2560 2561 2562 2563 2564 2565 2566 2567 2568 2569 2570 2571 2572 2573 2574 2575 2576 2577 2578 2579 2580 2581 2582 2583 2584 2585 2586 2587 2588 2589 2590 2591 2592 2593 2594 2595 2596 2597 2598 2599 2600 2601 2602 2603 2604 2605 2606 2607 2608 2609 2610 2611 2612 2613 2614 2615 2616 2617 2618 2619 2620 2621 2622 2623 2624 2625 2626 2627 2628 2629 2630 2631 2632 2633 2634 2635 2636 2637 2638 2639 2640 2641 2642 2643 2644 2645 2646 2647 2648 2649 2650 2651 2652 2653 2654 2655 2656 2657 2658 2659 2660 2661 2662 2663 2664 2665 2666 2667 2668 2669 2670 2671 2672 2673 2674 2675 2676 2677 2678 2679 2680 2681 2682 2683 2684 2685 2686 2687 2688 2689 2690 2691 2692 2693 2694 2695 2696 2697 2698 2699 2700 2701 2702 2703 2704 2705 2706 2707 2708 2709 2710 2711 2712 2713 2714 2715 2716 2717 2718 2719 2720 2721 2722 2723 2724 2725 2726 2727 2728 2729 2730 2731 2732 2733 2734 2735 2736 2737 2738 2739 2740 2741 2742 2743 2744 2745 2746 2747 2748 2749 2750 2751 2752 2753 2754 2755 2756 2757 2758 2759 2760 2761 2762 2763 2764 2765 2766 2767 2768 2769 2770 2771 2772 2773 2774 2775 2776 2777 2778 2779 2780 2781 2782 2783 2784 2785 2786 2787 2788 2789 2790 2791 2792 2793 2794 2795 2796 2797 2798 2799 2800 2801 2802 2803 2804 2805 2806 2807 2808 2809 2810 2811 2812 2813 2814 2815 2816 2817 2818 2819 2820 2821 2822 2823 2824 2825 2826 2827 2828 2829 2830 2831 2832 2833 2834 2835 2836 2837 2838 2839 2840 2841 2842 2843 2844 2845 2846 2847 2848 2849 2850 2851 2852 2853 2854 2855 2856 2857 2858 2859 2860 2861 2862 2863 2864 2865 2866 2867 2868 2869 2870 2871 2872 2873 2874 2875 2876 2877 2878 2879 2880 2881 2882 2883 2884 2885 2886 2887 2888 2889 2890 2891 2892 2893 2894 2895 2896 2897 2898 2899 2900 2901 2902 2903 2904 2905 2906 2907 2908 2909 2910 2911 2912 2913 2914 2915 2916 2917 2918 2919 2920 2921 2922 2923 2924 2925 2926 2927 2928 2929 2930 2931 2932 2933 2934 2935 2936 2937 2938 2939 2940 2941 2942 2943 2944 2945 2946 2947 2948 2949 2950 2951 2952 2953 2954 2955 2956 2957 2958 2959 2960 2961 2962 2963 2964 2965 2966 2967 2968 2969 2970 2971 2972 2973 2974 2975 2976 2977 2978 2979 2980 2981 2982 2983 2984 2985 2986 2987 2988 2989 2990 2991 2992 2993 2994 2995 2996 2997 2998 2999 3000 3001 3002 3003 3004 3005 3006 3007 3008 3009 3010 3011 3012 3013 3014 3015 3016 3017 3018 3019 3020 3021 3022 3023 3024 3025 3026 3027 3028 3029 3030 3031 3032 3033 3034 3035 3036 3037 3038 3039 3040 3041 3042 3043 3044 3045 3046 3047 3048 3049 3050 3051 3052 3053 3054 3055

Readme file for Introduction to OO Programming in Java


This readme file contains details of links to all the Introduction to OO Programming in Java module's material held on Jorum and information about the module as well.


ukoer | programming task guide | programming lecture | programming reading material | software design reading material | classes guide | libraries lecture | classes reading material | classes visual aid | software objects guide | graphics reading material | attributes reading material | attributes visual guide | naming conventions reading material | code reading material | java keywords reading material | variables visual guide | arithmetic reading material | java assignment | making decisions task guide | making decisions lecture | making decisions reading material | boolean expressions visual guide | repetition reading material | while loops visual guide | methods reading material | methods practical | access modifiers reading material | objects reading material | classes assignment | classes practical | child classes task guide | inheritance task guide | extending classes lecture | inheritance reading material | inheritance visual guide | inheritance practical | graphics task guide | awt reading material | graphics visual aid | awt class library reading material | event-driven programming reading material | scrollbars reading material | reflective practice visual guide | mobile phone task guide | mobile phone lecture | fixed repitition reading material | fixed repitition visual guide | mobile phone library reading material | mobile phone reading material | arrays task guide | arrays lecture | arrays reading material | arrays visual guide | creating software objects reading material | software objects visual guide | java practical | generic array list task guide | overriding methods reading material | menu and switch task guide | multi-way decisions reading material | multi-way decisions visual guide | searching task guide | searching lecture | searching reading material | software quality task guide | software quality lecture | software quality reading material | programming assignment | applet reading material | classes visual guide | object-oriented programming | object-oriented | programming | java | problem solving | java program | software design | programming languages | computers | class task guide | class reading material | class assignment | class practical | java classes | variables | attributes | arithmetic | java class | classes and arithmetic | classes | class | decisions | boolean expression | boolean expressions | repetition | methods | aggregate classes | access modifier | access modifiers | child classes | inheritance | child class | graphics | awt class library | fixed repetition | for loop | for loops | array | arrays | iteration | software object | definite iteration | generic lists | generic array list | cast | casting | overriding method | overriding methods | generic list | menu-driven program | menu-driven programs | multi-way decisions | menu and switch | search | searching | software quality | testing | software quality and testing | assessment | computers task guide | programming languages task guide | software design task guide | java program task guide | problem-solving task guide | problem solving task guide | object-oriented programming task guide | java task guide | object-oriented task guide | object oriented task guide | computers lecture | programming languages lecture | software design lecture | java program lecture | problem solving lecture | object-oriented programming lecture | java lecture | object oriented programming lecture | object-oriented lecture | computers reading material | programming languages reading material | java program reading material | problem solving reading material | object-oriented programming reading material | java reading material | object-oriented reading material | object oriented reading material | java classes task guide | variables task guide | attributes task guide | arithmetic task guide | java class task guide | classes and arithmetic task guide | classes task guide | java classes lecture | variables lecture | attributes lecture | arithmetic lecture | java class lecture | classes and arithmetic lecture | classes lecture | class lecture | java classes reading material | variables reading material | java class reading material | classes and arithmetic reading material | java classes visual aid | variables visual aid | attributes visual aid | arithmetic visual aid | java class visual aid | classes and arithmetic visual aid | class visual aid | java visual aid | object-oriented programming visual aid | programming visual aid | object-oriented visual aid | decisions task guide | boolean expression task guide | boolean expressions task guide | repetition task guide | methods task guide | decisions lecture | boolean expression lecture | boolean expressions lecture | repetition lecture | methods lecture | decisions reading material | boolean expression reading material | boolean expressions reading material | decisions visual aid | boolean expression visual aid | boolean expressions visual aid | repetition visual aid | methods visual aid | decisions practical | boolean expression practical | boolean expressions practical | repetition practical | programming practical | object oriented programming practical | object-oriented programming practical | object-oriented practical | object oriented practical | aggregate classes task guide | access modifier task guide | access modifiers task guide | aggregate classes lecture | access modifier lecture | access modifiers lecture | aggregate classes reading material | access modifier reading material | aggregate classes assignment | java classes assignment | access modifier assignment | access modifiers assignment | object oriented programming assignment | object-oriented programming assignment | object-oriented assignment | object oriented assignment | child class task guide | child classes lecture | inheritance lecture | child class lecture | child classes reading material | child class reading material | child classes visual aid | inheritance visual aid | child class visual aid | awt class library task guide | graphics lecture | awt class library lecture | awt class library visual aid | graphics assignment | awt class library assignment | fixed repetition task guide | fixed repetition lecture | fixed repetition visual aid | fixed repetition reading material | for loop task guide | for loops task guide | array task guide | iteration task guide | software object task guide | definite iteration task guide | for loop lecture | for loops lecture | array lecture | iteration lecture | software object lecture | definite iteration lecture | for loop reading material | for loops reading material | array reading material | iteration reading material | software object reading material | definite iteration reading material | for loop visual aid | for loops visual aid | array visual aid | arrays visual aid | iteration visual aid | software object visual aid | definite iteration visual aid | generic lists task guide | cast task guide | casting task guide | overriding method task guide | overriding methods task guide | generic list task guide | generic lists lecture | generic array list lecture | cast lecture | casting lecture | overriding method lecture | overriding methods lecture | generic list lecture | generic lists reading material | generic array list reading material | cast reading material | casting reading material | overriding method reading material | generic list reading material | menu-driven program task guide | menu-driven programs task guide | multi-way decisions task guide | menu-driven program lecture | menu-driven programs lecture | multi-way decisions lecture | menu and switch lecture | menu-driven program reading material | menu-driven programs reading material | menu and switch reading material | menu-driven program visual aid | menu-driven programs visual aid | multi-way decisions visual aid | menu and switch visual aid | search task guide | search lecture | search reading material | testing task guide | software quality and testing task guide | testing lecture | software quality and testing lecture | testing reading material | software quality and testing reading material | assessment reading material | assessment assignment | fixed repetition practical | jcreator guide | g622 | oo | oop | oo programming | awt | oo programming task guide | oop task guide | oo task guide | g622 task guide | oo programming lecture | oop lecture | oo lecture | g622 lecture | oo programming reading material | oop reading material | oo reading material | g622 reading material | g622 visual aid | oop visual aid | oo visual aid | oo programming visual aid | g622 practical | oo practical | oo programming practical | oop practical | g622 assignment | oo assignment | oop assignment | oo programming assignment | awt task guide | awt lecture | awt visual aid | awt assignment | Computer science | I100


Attribution-Noncommercial-Share Alike 2.0 UK: England & Wales Attribution-Noncommercial-Share Alike 2.0 UK: England & Wales

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Readme file for Distributed Web Systems


This readme file contains details of links to all the Distributed Web Systems module's material held on Jorum and information about the module as well.


ukoer | web system tutorial | distributed system tutorial | web systems tutorial | distributed system lecture | web systems lecture | web system lecture | introduction to distributed systems lecture | interprocess communications | tomcat reading material | distributed systems architecture | interprocess communications lecture | distributed systems architecture quiz | web systems | distributed system | web system | servlets practical | distributed systems lecture | servlets tutorial | distributed systems quiz | java networking practical | distributed objects and remote method invocation lecture | distributed objects and rmi quiz | time and global state lecture | distributed systems architectures | distributed web systems | distributed web system | remote methods invocation practical | distributed systems | java servlet | transactions and currency control quiz | coordination and agreement lecture | coordination and agreement quiz | time control practical | replication lecture | java servlets | election algorithms practical | mvc approach practical | introduction to distributed web systems | distributed file systems lecture | cookies tutorial | session tracking tutorial | distributed objects lecture | web system quiz | distributed system quiz | web system practical | distributed web systems practical | distributed web system practical | distributed web system quiz | interprocess communication practical | distributed systems tutorial | distributed system practical | distributed web systems tutorial | distributed web systems lecture | distributed web systems quiz | distributed systems practical | java servlet practical | java servlets practical | interprocess communication quiz | distributed systems architectures quiz | distributed objects | distributed systems architecture lecture | distributed web system lecture | java servlet reading material | web system reading material | java servlets reading material | web systems reading material | distributed web systems reading material | distributed web system reading material | v | introduction to distributed web systems lecture | java servlets lecture | distributed web system tutorial | cookies and session tracking tutorial | distributed object lecture | distributed objects and remote method invocation practical | remote method invocation lecture | web systems quiz | fundamental models in distributed systems quiz | interprocess communications practical | web systems practical | request data tutorial | response data tutorial | servlet tutorial | java servlets tutorial | fundamental models in distributed systems lecture | interprocess communications quiz | interprocess communication lecture | distributed systems architectures lecture | distributed system reading material | distributed systems reading material | java servlet lecture | distributed objects quiz | remote method invocation quiz | distributed objects and remote method invocation quiz | distributed object quiz | fundamental models in distributed systems practical | time and global states lecture | java server pages tutorial | java server page tutorial | jsp tutorial | time and global state quiz | time and global states quiz | remote method invocation practical | distributed objects practical | distributed object practical | transactions and currency control lecture | transaction lecture | concurrency lecture | concurrency control lecture | transaction quiz | concurrency quiz | concurrency control quiz | request data practical | response data practical | servlet practical | cookies practical | session tracking practical | cookies and session tracking practical | time and global state practical | time and global states practical | java server pages practical | java server page practical | jsp practical | java beans tutorial | replication quiz | p2p lecture | peer to peer systems lecture | peer to peer system lecture | model-view-controller architecture tutorial | p2p quiz | peer to peer systems quiz | peer to peer system quiz | coordination and agreement practical | java beans practical | name services lecture | name service lecture | name services quiz | name service quiz | model-view-controller architecture practical | web services lecture | semantic web lecture | web services quiz | semantic web quiz | web services practical | semantic web practical | distributed file systems quiz | interprocess communication | fundamental models in distributed systems | request data | response data | servlet | remote method invocation | distributed objects and remote method invocation | distributed object | cookies | session tracking | cookies and session tracking | time and global state | time and global states | java server pages | java server page | jsp | transactions and currency control | transaction | concurrency | concurrency control | coordination and agreement | replication | java beans | p2p | peer to peer systems | peer to peer system | model-view-controller architecture | name services | name service | web services | semantic web | distributed file systems | jdbc tutorial | java database connectivity tutorial | jdbc practical | java database connectivity practical | jdbc | java database connectivity | Computer science | I100


Attribution-Noncommercial-Share Alike 2.0 UK: England & Wales Attribution-Noncommercial-Share Alike 2.0 UK: England & Wales

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

18.327 Wavelets, Filter Banks and Applications (MIT) 18.327 Wavelets, Filter Banks and Applications (MIT)


Wavelets are localized basis functions, good for representing short-time events. The coefficients at each scale are filtered and subsampled to give coefficients at the next scale. This is Mallat's pyramid algorithm for multiresolution, connecting wavelets to filter banks. Wavelets and multiscale algorithms for compression and signal/image processing are developed. Subject is project-based for engineering and scientific applications. Wavelets are localized basis functions, good for representing short-time events. The coefficients at each scale are filtered and subsampled to give coefficients at the next scale. This is Mallat's pyramid algorithm for multiresolution, connecting wavelets to filter banks. Wavelets and multiscale algorithms for compression and signal/image processing are developed. Subject is project-based for engineering and scientific applications.


Discrete-time filters | Discrete-time filters | convolution | convolution | Fourier transform | Fourier transform | owpass and highpass filters | owpass and highpass filters | Sampling rate change operations | Sampling rate change operations | upsampling and downsampling | upsampling and downsampling | ractional sampling | ractional sampling | interpolation | interpolation | Filter Banks | Filter Banks | time domain (Haar example) and frequency domain | time domain (Haar example) and frequency domain | conditions for alias cancellation and no distortion | conditions for alias cancellation and no distortion | perfect reconstruction | perfect reconstruction | halfband filters and possible factorizations | halfband filters and possible factorizations | Modulation and polyphase representations | Modulation and polyphase representations | Noble identities | Noble identities | block Toeplitz matrices and block z-transforms | block Toeplitz matrices and block z-transforms | polyphase examples | polyphase examples | Matlab wavelet toolbox | Matlab wavelet toolbox | Orthogonal filter banks | Orthogonal filter banks | paraunitary matrices | paraunitary matrices | orthogonality condition (Condition O) in the time domain | orthogonality condition (Condition O) in the time domain | modulation domain and polyphase domain | modulation domain and polyphase domain | Maxflat filters | Maxflat filters | Daubechies and Meyer formulas | Daubechies and Meyer formulas | Spectral factorization | Spectral factorization | Multiresolution Analysis (MRA) | Multiresolution Analysis (MRA) | requirements for MRA | requirements for MRA | nested spaces and complementary spaces; scaling functions and wavelets | nested spaces and complementary spaces; scaling functions and wavelets | Refinement equation | Refinement equation | iterative and recursive solution techniques | iterative and recursive solution techniques | infinite product formula | infinite product formula | filter bank approach for computing scaling functions and wavelets | filter bank approach for computing scaling functions and wavelets | Orthogonal wavelet bases | Orthogonal wavelet bases | connection to orthogonal filters | connection to orthogonal filters | orthogonality in the frequency domain | orthogonality in the frequency domain | Biorthogonal wavelet bases | Biorthogonal wavelet bases | Mallat pyramid algorithm | Mallat pyramid algorithm | Accuracy of wavelet approximations (Condition A) | Accuracy of wavelet approximations (Condition A) | vanishing moments | vanishing moments | polynomial cancellation in filter banks | polynomial cancellation in filter banks | Smoothness of wavelet bases | Smoothness of wavelet bases | convergence of the cascade algorithm (Condition E) | convergence of the cascade algorithm (Condition E) | splines | splines | Bases vs. frames | Bases vs. frames | Signal and image processing | Signal and image processing | finite length signals | finite length signals | boundary filters and boundary wavelets | boundary filters and boundary wavelets | wavelet compression algorithms | wavelet compression algorithms | Lifting | Lifting | ladder structure for filter banks | ladder structure for filter banks | factorization of polyphase matrix into lifting steps | factorization of polyphase matrix into lifting steps | lifting form of refinement equationSec | lifting form of refinement equationSec | Wavelets and subdivision | Wavelets and subdivision | nonuniform grids | nonuniform grids | multiresolution for triangular meshes | multiresolution for triangular meshes | representation and compression of surfaces | representation and compression of surfaces | Numerical solution of PDEs | Numerical solution of PDEs | Galerkin approximation | Galerkin approximation | wavelet integrals (projection coefficients | moments and connection coefficients) | wavelet integrals (projection coefficients | moments and connection coefficients) | convergence | convergence | Subdivision wavelets for integral equations | Subdivision wavelets for integral equations | Compression and convergence estimates | Compression and convergence estimates | M-band wavelets | M-band wavelets | DFT filter banks and cosine modulated filter banks | DFT filter banks and cosine modulated filter banks | Multiwavelets | Multiwavelets


Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Willard, Martin Collection _000104



submarine | convair | sdv | generaldynamics | submersible | swimmerdeliveryvehicle | vision:text=0619 | vision:outdoor=0834 | vision:car=0677 | martinwillard | model48charger | convairmodel14 | swimmerdeliveryvehiclemarkvii | sdvmarkvii | swimmerdeliveryvehiclemark7 | sdvmark7 | swimmerdeliveryvehiclemkvii | sdvmkvii | swimmerdeliveryvehiclemk7 | sdvmk7 | swimmerdeliveryvehiclemarkviimod6 | sdvmarkviimod6 | swimmerdeliveryvehiclemark7mod6 | sdvmark7mod6 | swimmerdeliveryvehiclemkviimod6 | sdvmkviimod6 | swimmerdeliveryvehiclemk7mod6 | sdvmk7mod6 | mkviisdv | mkviimod6sdv | mk7sdv | mk7mod6sdv


No known copyright restrictions

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Willard, Martin Collection _000103



submarine | convair | sdv | generaldynamics | submersible | swimmerdeliveryvehicle | vision:car=0776 | vision:outdoor=0725 | martinwillard | model48charger | convairmodel14 | swimmerdeliveryvehiclemarkvii | sdvmarkvii | swimmerdeliveryvehiclemark7 | sdvmark7 | swimmerdeliveryvehiclemkvii | sdvmkvii | swimmerdeliveryvehiclemk7 | sdvmk7 | swimmerdeliveryvehiclemarkviimod6 | sdvmarkviimod6 | swimmerdeliveryvehiclemark7mod6 | sdvmark7mod6 | swimmerdeliveryvehiclemkviimod6 | sdvmkviimod6 | swimmerdeliveryvehiclemk7mod6 | sdvmk7mod6 | mkviisdv | mkviimod6sdv | mk7sdv | mk7mod6sdv


No known copyright restrictions

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Willard, Martin Collection _000108



crane | submarine | convair | sdv | generaldynamics | submersible | swimmerdeliveryvehicle | loraincrane | vision:outdoor=0903 | vision:car=057 | martinwillard | model48charger | convairmodel14 | swimmerdeliveryvehiclemarkvii | sdvmarkvii | swimmerdeliveryvehiclemark7 | sdvmark7 | swimmerdeliveryvehiclemkvii | sdvmkvii | swimmerdeliveryvehiclemk7 | sdvmk7 | swimmerdeliveryvehiclemarkviimod6 | sdvmarkviimod6 | swimmerdeliveryvehiclemark7mod6 | sdvmark7mod6 | swimmerdeliveryvehiclemkviimod6 | sdvmkviimod6 | swimmerdeliveryvehiclemk7mod6 | sdvmk7mod6 | mkviisdv | mkviimod6sdv | mk7sdv | mk7mod6sdv


No known copyright restrictions

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

髇 y Actividad de las Administraciones P鷅licas 髇 y Actividad de las Administraciones P鷅licas


La asignatura se centra en el estudio de tres aspectos esenciales de la Administraci髇 p鷅lica: su organizaci髇, su actividad y el control de dicha actuaci髇. La asignatura se centra en el estudio de tres aspectos esenciales de la Administraci髇 p鷅lica: su organizaci髇, su actividad y el control de dicha actuaci髇.


Eficacia de los actos administrativos | Eficacia de los actos administrativos | Provincia | Provincia | Nulidad de los actos administrativos | Nulidad de los actos administrativos | | | Competencia | Competencia | Conflictos de competencia | Conflictos de competencia | Potestad organizatoria | Potestad organizatoria | Grado en Derecho | Grado en Derecho | Agencias | Agencias | Procedimientos especiales | Procedimientos especiales | 醤icas | 醤icas | Procedimiento ordinario | Procedimiento ordinario | Derecho Administrativo | Derecho Administrativo | Recursos contra las resoluciones judiciales | Recursos contra las resoluciones judiciales | Objeto del recurso contencioso-administrativo | Objeto del recurso contencioso-administrativo | 髇 Administrativa | 髇 Administrativa | Procedimiento abreviado | Procedimiento abreviado | 2016 | 2016 | Procedimiento administrativo | Procedimiento administrativo | Municipio | Municipio | 2012 | 2012 | 髆icas | 髆icas | Plazos del procedimiento | Plazos del procedimiento | 髇 General del Estado | 髇 General del Estado | 髆icos | 髆icos | 鷅licos | 鷅licos | Fundaciones | Fundaciones | 髇 corporativa | 髇 corporativa | Silencio administrativo | Silencio administrativo | 間imen de invalidez de los actos administrativos | 間imen de invalidez de los actos administrativos | Anulabilidad de los actos administrativos | Anulabilidad de los actos administrativos | Sociedades | Sociedades | 鷑ica instancia | 鷑ica instancia | 髇 de los actos administrativos | 髇 de los actos administrativos | 髇 de oficio de los actos administrativos | 髇 de oficio de los actos administrativos | 髇 instrumental | 髇 instrumental | 髇omas | 髇omas | Acto administrativo | Acto administrativo | 韆 local | 韆 local | 髇 de las Administraciones | 髇 de las Administraciones | 髇 contencioso-administrativa | 髇 contencioso-administrativa | 髇 de sentencias | 髇 de sentencias | 觬ganos administrativos | 觬ganos administrativos | 髇 forzosa de los actos administrativos | 髇 forzosa de los actos administrativos | Unidades administrativas | Unidades administrativas | Recurso de alzada | Recurso de alzada | Relaciones interadministrativas | Relaciones interadministrativas | 韆 administrativa | 韆 administrativa | Administraciones Locales | Administraciones Locales | Tutela cautelar | Tutela cautelar


Copyright 2015, UC3M

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata



Includes audio/video content: AV selected lectures, AV faculty introductions, AV special element video. The basic objective of Unified Engineering is to give a solid understanding of the fundamental disciplines of aerospace engineering, as well as their interrelationships and applications. These disciplines are Materials and Structures (M); Computers and Programming (C); Fluid Mechanics (F); Thermodynamics (T); Propulsion (P); and Signals and Systems (S). In choosing to teach these subjects in a unified manner, the instructors seek to explain the common intellectual threads in these disciplines, as well as their combined application to solve engineering Systems Problems (SP). Throughout the year, the instructors emphasize the connections among the disciplines. Includes audio/video content: AV selected lectures, AV faculty introductions, AV special element video. The basic objective of Unified Engineering is to give a solid understanding of the fundamental disciplines of aerospace engineering, as well as their interrelationships and applications. These disciplines are Materials and Structures (M); Computers and Programming (C); Fluid Mechanics (F); Thermodynamics (T); Propulsion (P); and Signals and Systems (S). In choosing to teach these subjects in a unified manner, the instructors seek to explain the common intellectual threads in these disciplines, as well as their combined application to solve engineering Systems Problems (SP). Throughout the year, the instructors emphasize the connections among the disciplines.


Unified | Unified | Unified Engineering | Unified Engineering | aerospace | aerospace | CDIO | CDIO | C-D-I-O | C-D-I-O | conceive | conceive | design | design | implement | implement | operate | operate | team | team | team-based | team-based | discipline | discipline | materials | materials | structures | structures | materials and structures | materials and structures | computers | computers | programming | programming | computers and programming | computers and programming | fluids | fluids | fluid mechanics | fluid mechanics | thermodynamics | thermodynamics | propulsion | propulsion | signals | signals | systems | systems | signals and systems | signals and systems | systems problems | systems problems | fundamentals | fundamentals | technical communication | technical communication | graphical communication | graphical communication | communication | communication | reading | reading | research | research | experimentation | experimentation | personal response system | personal response system | prs | prs | active learning | active learning | First law | First law | first law of thermodynamics | first law of thermodynamics | thermo-mechanical | thermo-mechanical | energy | energy | energy conversion | energy conversion | aerospace power systems | aerospace power systems | propulsion systems | propulsion systems | aerospace propulsion systems | aerospace propulsion systems | heat | heat | work | work | thermal efficiency | thermal efficiency | forms of energy | forms of energy | energy exchange | energy exchange | processes | processes | heat engines | heat engines | engines | engines | steady-flow energy equation | steady-flow energy equation | energy flow | energy flow | flows | flows | path-dependence | path-dependence | path-independence | path-independence | reversibility | reversibility | irreversibility | irreversibility | state | state | thermodynamic state | thermodynamic state | performance | performance | ideal cycle | ideal cycle | simple heat engine | simple heat engine | cycles | cycles | thermal pressures | thermal pressures | temperatures | temperatures | linear static networks | linear static networks | loop method | loop method | node method | node method | linear dynamic networks | linear dynamic networks | classical methods | classical methods | state methods | state methods | state concepts | state concepts | dynamic systems | dynamic systems | resistive circuits | resistive circuits | sources | sources | voltages | voltages | currents | currents | Thevinin | Thevinin | Norton | Norton | initial value problems | initial value problems | RLC networks | RLC networks | characteristic values | characteristic values | characteristic vectors | characteristic vectors | transfer function | transfer function | ada | ada | ada programming | ada programming | programming language | programming language | software systems | software systems | programming style | programming style | computer architecture | computer architecture | program language evolution | program language evolution | classification | classification | numerical computation | numerical computation | number representation systems | number representation systems | assembly | assembly | SimpleSIM | SimpleSIM | RISC | RISC | CISC | CISC | operating systems | operating systems | single user | single user | multitasking | multitasking | multiprocessing | multiprocessing | domain-specific classification | domain-specific classification | recursive | recursive | execution time | execution time | fluid dynamics | fluid dynamics | physical properties of a fluid | physical properties of a fluid | fluid flow | fluid flow | mach | mach | reynolds | reynolds | conservation | conservation | conservation principles | conservation principles | conservation of mass | conservation of mass | conservation of momentum | conservation of momentum | conservation of energy | conservation of energy | continuity | continuity | inviscid | inviscid | steady flow | steady flow | simple bodies | simple bodies | airfoils | airfoils | wings | wings | channels | channels | aerodynamics | aerodynamics | forces | forces | moments | moments | equilibrium | equilibrium | freebody diagram | freebody diagram | free-body | free-body | free body | free body | planar force systems | planar force systems | equipollent systems | equipollent systems | equipollence | equipollence | support reactions | support reactions | reactions | reactions | static determinance | static determinance | determinate systems | determinate systems | truss analysis | truss analysis | trusses | trusses | method of joints | method of joints | method of sections | method of sections | statically indeterminate | statically indeterminate | three great principles | three great principles | 3 great principles | 3 great principles | indicial notation | indicial notation | rotation of coordinates | rotation of coordinates | coordinate rotation | coordinate rotation | stress | stress | extensional stress | extensional stress | shear stress | shear stress | notation | notation | plane stress | plane stress | stress equilbrium | stress equilbrium | stress transformation | stress transformation | mohr | mohr | mohr's circle | mohr's circle | principal stress | principal stress | principal stresses | principal stresses | extreme shear stress | extreme shear stress | strain | strain | extensional strain | extensional strain | shear strain | shear strain | strain-displacement | strain-displacement | compatibility | compatibility | strain transformation | strain transformation | transformation of strain | transformation of strain | mohr's circle for strain | mohr's circle for strain | principal strain | principal strain | extreme shear strain | extreme shear strain | uniaxial stress-strain | uniaxial stress-strain | material properties | material properties | classes of materials | classes of materials | bulk material properties | bulk material properties | origin of elastic properties | origin of elastic properties | structures of materials | structures of materials | atomic bonding | atomic bonding | packing of atoms | packing of atoms | atomic packing | atomic packing | crystals | crystals | crystal structures | crystal structures | polymers | polymers | estimate of moduli | estimate of moduli | moduli | moduli | composites | composites | composite materials | composite materials | modulus limited design | modulus limited design | material selection | material selection | materials selection | materials selection | measurement of elastic properties | measurement of elastic properties | stress-strain | stress-strain | stress-strain relations | stress-strain relations | anisotropy | anisotropy | orthotropy | orthotropy | measurements | measurements | engineering notation | engineering notation | Hooke | Hooke | Hooke's law | Hooke's law | general hooke's law | general hooke's law | equations of elasticity | equations of elasticity | boundary conditions | boundary conditions | multi-disciplinary | multi-disciplinary | models | models | engineering systems | engineering systems | experiments | experiments | investigations | investigations | experimental error | experimental error | design evaluation | design evaluation | evaluation | evaluation | trade studies | trade studies | effects of engineering | effects of engineering | social context | social context | engineering drawings | engineering drawings


Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata



The basic objective of Unified Engineering is to give a solid understanding of the fundamental disciplines of aerospace engineering, as well as their interrelationships and applications. These disciplines are Materials and Structures (M); Computers and Programming (C); Fluid Mechanics (F); Thermodynamics (T); Propulsion (P); and Signals and Systems (S). In choosing to teach these subjects in a unified manner, the instructors seek to explain the common intellectual threads in these disciplines, as well as their combined application to solve engineering Systems Problems (SP). Throughout the year, the instructors emphasize the connections among the disciplines.Technical RequirementsMicrosoft® Excel software is recommended for viewing the .xls files The basic objective of Unified Engineering is to give a solid understanding of the fundamental disciplines of aerospace engineering, as well as their interrelationships and applications. These disciplines are Materials and Structures (M); Computers and Programming (C); Fluid Mechanics (F); Thermodynamics (T); Propulsion (P); and Signals and Systems (S). In choosing to teach these subjects in a unified manner, the instructors seek to explain the common intellectual threads in these disciplines, as well as their combined application to solve engineering Systems Problems (SP). Throughout the year, the instructors emphasize the connections among the disciplines.Technical RequirementsMicrosoft® Excel software is recommended for viewing the .xls files


Unified | Unified | Unified Engineering | Unified Engineering | aerospace | aerospace | CDIO | CDIO | C-D-I-O | C-D-I-O | conceive | conceive | design | design | implement | implement | operate | operate | team | team | team-based | team-based | discipline | discipline | materials | materials | structures | structures | materials and structures | materials and structures | computers | computers | programming | programming | computers and programming | computers and programming | fluids | fluids | fluid mechanics | fluid mechanics | thermodynamics | thermodynamics | propulsion | propulsion | signals | signals | systems | systems | signals and systems | signals and systems | systems problems | systems problems | fundamentals | fundamentals | technical communication | technical communication | graphical communication | graphical communication | communication | communication | reading | reading | research | research | experimentation | experimentation | personal response system | personal response system | prs | prs | active learning | active learning | First law | First law | first law of thermodynamics | first law of thermodynamics | thermo-mechanical | thermo-mechanical | energy | energy | energy conversion | energy conversion | aerospace power systems | aerospace power systems | propulsion systems | propulsion systems | aerospace propulsion systems | aerospace propulsion systems | heat | heat | work | work | thermal efficiency | thermal efficiency | forms of energy | forms of energy | energy exchange | energy exchange | processes | processes | heat engines | heat engines | engines | engines | steady-flow energy equation | steady-flow energy equation | energy flow | energy flow | flows | flows | path-dependence | path-dependence | path-independence | path-independence | reversibility | reversibility | irreversibility | irreversibility | state | state | thermodynamic state | thermodynamic state | performance | performance | ideal cycle | ideal cycle | simple heat engine | simple heat engine | cycles | cycles | thermal pressures | thermal pressures | temperatures | temperatures | linear static networks | linear static networks | loop method | loop method | node method | node method | linear dynamic networks | linear dynamic networks | classical methods | classical methods | state methods | state methods | state concepts | state concepts | dynamic systems | dynamic systems | resistive circuits | resistive circuits | sources | sources | voltages | voltages | currents | currents | Thevinin | Thevinin | Norton | Norton | initial value problems | initial value problems | RLC networks | RLC networks | characteristic values | characteristic values | characteristic vectors | characteristic vectors | transfer function | transfer function | ada | ada | ada programming | ada programming | programming language | programming language | software systems | software systems | programming style | programming style | computer architecture | computer architecture | program language evolution | program language evolution | classification | classification | numerical computation | numerical computation | number representation systems | number representation systems | assembly | assembly | SimpleSIM | SimpleSIM | RISC | RISC | CISC | CISC | operating systems | operating systems | single user | single user | multitasking | multitasking | multiprocessing | multiprocessing | domain-specific classification | domain-specific classification | recursive | recursive | execution time | execution time | fluid dynamics | fluid dynamics | physical properties of a fluid | physical properties of a fluid | fluid flow | fluid flow | mach | mach | reynolds | reynolds | conservation | conservation | conservation principles | conservation principles | conservation of mass | conservation of mass | conservation of momentum | conservation of momentum | conservation of energy | conservation of energy | continuity | continuity | inviscid | inviscid | steady flow | steady flow | simple bodies | simple bodies | airfoils | airfoils | wings | wings | channels | channels | aerodynamics | aerodynamics | forces | forces | moments | moments | equilibrium | equilibrium | freebody diagram | freebody diagram | free-body | free-body | free body | free body | planar force systems | planar force systems | equipollent systems | equipollent systems | equipollence | equipollence | support reactions | support reactions | reactions | reactions | static determinance | static determinance | determinate systems | determinate systems | truss analysis | truss analysis | trusses | trusses | method of joints | method of joints | method of sections | method of sections | statically indeterminate | statically indeterminate | three great principles | three great principles | 3 great principles | 3 great principles | indicial notation | indicial notation | rotation of coordinates | rotation of coordinates | coordinate rotation | coordinate rotation | stress | stress | extensional stress | extensional stress | shear stress | shear stress | notation | notation | plane stress | plane stress | stress equilbrium | stress equilbrium | stress transformation | stress transformation | mohr | mohr | mohr's circle | mohr's circle | principal stress | principal stress | principal stresses | principal stresses | extreme shear stress | extreme shear stress | strain | strain | extensional strain | extensional strain | shear strain | shear strain | strain-displacement | strain-displacement | compatibility | compatibility | strain transformation | strain transformation | transformation of strain | transformation of strain | mohr's circle for strain | mohr's circle for strain | principal strain | principal strain | extreme shear strain | extreme shear strain | uniaxial stress-strain | uniaxial stress-strain | material properties | material properties | classes of materials | classes of materials | bulk material properties | bulk material properties | origin of elastic properties | origin of elastic properties | structures of materials | structures of materials | atomic bonding | atomic bonding | packing of atoms | packing of atoms | atomic packing | atomic packing | crystals | crystals | crystal structures | crystal structures | polymers | polymers | estimate of moduli | estimate of moduli | moduli | moduli | composites | composites | composite materials | composite materials | modulus limited design | modulus limited design | material selection | material selection | materials selection | materials selection | measurement of elastic properties | measurement of elastic properties | stress-strain | stress-strain | stress-strain relations | stress-strain relations | anisotropy | anisotropy | orthotropy | orthotropy | measurements | measurements | engineering notation | engineering notation | Hooke | Hooke | Hooke's law | Hooke's law | general hooke's law | general hooke's law | equations of elasticity | equations of elasticity | boundary conditions | boundary conditions | multi-disciplinary | multi-disciplinary | models | models | engineering systems | engineering systems | experiments | experiments | investigations | investigations | experimental error | experimental error | design evaluation | design evaluation | evaluation | evaluation | trade studies | trade studies | effects of engineering | effects of engineering | social context | social context | engineering drawings | engineering drawings | 16.01 | 16.01 | 16.02 | 16.02 | 16.03 | 16.03 | 16.04 | 16.04


Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Willard, Martin Collection _000107



submarine | convair | sdv | generaldynamics | submersible | swimmerdeliveryvehicle | martinwillard | model48charger | convairmodel14 | swimmerdeliveryvehiclemarkvii | sdvmarkvii | swimmerdeliveryvehiclemark7 | sdvmark7 | swimmerdeliveryvehiclemkvii | sdvmkvii | swimmerdeliveryvehiclemk7 | sdvmk7 | swimmerdeliveryvehiclemarkviimod6 | sdvmarkviimod6 | swimmerdeliveryvehiclemark7mod6 | sdvmark7mod6 | swimmerdeliveryvehiclemkviimod6 | sdvmkviimod6 | swimmerdeliveryvehiclemk7mod6 | sdvmk7mod6 | mkviisdv | mkviimod6sdv | mk7sdv | mk7mod6sdv


No known copyright restrictions

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

12.802 Wave Motions in the Ocean and Atmosphere (MIT) 12.802 Wave Motions in the Ocean and Atmosphere (MIT)


This course is an introduction to basic ideas of geophysical wave motion in rotating, stratified, and rotating-stratified fluids. Subject begins with general wave concepts of phase and group velocity. It also covers the dynamics and kinematics of gravity waves with a focus on dispersion, energy flux, initial value problems, etc. Also addressed are subject foundation used to study internal and inertial waves, Kelvin, Poincare, and Rossby waves in homogeneous and stratified fluids. Laplace tidal equations are applied to equatorial waves. Other topics include: resonant interactions, potential vorticity, wave-mean flow interactions, and instability. This course is an introduction to basic ideas of geophysical wave motion in rotating, stratified, and rotating-stratified fluids. Subject begins with general wave concepts of phase and group velocity. It also covers the dynamics and kinematics of gravity waves with a focus on dispersion, energy flux, initial value problems, etc. Also addressed are subject foundation used to study internal and inertial waves, Kelvin, Poincare, and Rossby waves in homogeneous and stratified fluids. Laplace tidal equations are applied to equatorial waves. Other topics include: resonant interactions, potential vorticity, wave-mean flow interactions, and instability.


geophysical wave motion | geophysical wave motion | rotating | stratified | and rotating-stratified fluids | rotating | stratified | and rotating-stratified fluids | general wave concepts | general wave concepts | phase | phase | group velocity | group velocity | dynamics and kinematics of gravity waves | dynamics and kinematics of gravity waves | dispersion | dispersion | energy flux | energy flux | initial value problems | initial value problems | internal and inertial waves | internal and inertial waves | Kelvin | Kelvin | Poincare | Poincare | and Rossby waves | and Rossby waves | homogeneous and stratified fluids | homogeneous and stratified fluids | Laplace tidal equations | Laplace tidal equations | equatorial waves | equatorial waves | resonant interactions | resonant interactions | potential vorticity | potential vorticity | wave-mean flow interactions | wave-mean flow interactions | instability | instability | 12. Kelvin | Poincare | and Rossby waves | 12. Kelvin | Poincare | and Rossby waves | Kelvin | Poincare | and Rossby waves | Kelvin | Poincare | and Rossby waves | internal gravity waves | internal gravity waves | surface gravity waves | surface gravity waves | rotation | rotation | large-scale hydrostatic motions | large-scale hydrostatic motions | vertical structure equation | vertical structure equation | equatorial ?-plane | equatorial ?-plane | Stratified Quasi-Geostrophic Motion | Stratified Quasi-Geostrophic Motion


Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Geometr铆a Gr谩fica Inform谩tica en Arquitectura I Geometr铆a Gr谩fica Inform谩tica en Arquitectura I


Teor铆a geom茅trica del objeto arquitect贸nico con herramientas inform谩ticas. Esta asignatura se ocupa del estudio de las formas espaciales relacionadas con la arquitectura y de su representaci贸n, mediante el uso de los medios inform谩ticos. Puede considerarse, en parte, como una profundizaci贸n y ampliaci贸n de los conocimientos adquiridos por el alumno en Geometr铆a Descriptiva; por otro lado, supone la aplicaci贸n, seg煤n los medios inform谩ticos, de conceptos referentes a la expresi贸n gr谩fica aprendidos en otras asignaturas de este mismo 脕rea. Teor铆a geom茅trica del objeto arquitect贸nico con herramientas inform谩ticas. Esta asignatura se ocupa del estudio de las formas espaciales relacionadas con la arquitectura y de su representaci贸n, mediante el uso de los medios inform谩ticos. Puede considerarse, en parte, como una profundizaci贸n y ampliaci贸n de los conocimientos adquiridos por el alumno en Geometr铆a Descriptiva; por otro lado, supone la aplicaci贸n, seg煤n los medios inform谩ticos, de conceptos referentes a la expresi贸n gr谩fica aprendidos en otras asignaturas de este mismo 脕rea.


B贸veda | B贸veda | Expresi贸n Gr谩fica en la Ingenier铆a | Expresi贸n Gr谩fica en la Ingenier铆a | M贸dulo | M贸dulo | 3D network | 3D network | Laboratorios Jorba | Laboratorios Jorba | Modelado | Modelado | Extrusi贸n | Extrusi贸n | Construcciones Arquitect贸nicas | Construcciones Arquitect贸nicas | Red plana | Red plana | Mezquita Mihrimah | Mezquita Mihrimah | Orden toscano | Orden toscano | Dome | Dome | Platonic solids | Platonic solids | Dibujo | Dibujo | Booleana | Booleana | Graphic | Graphic | Solid | Solid | Dibujo 3D | Dibujo 3D | Arquitecto | Arquitecto | Architect | Architect | Poliedros semirregulares | Poliedros semirregulares | Hiperboloides | Hiperboloides | Polyhedron | Polyhedron | NURBS | NURBS | Render | Render | Malla | Malla | Computing | Computing | Ermita de la Virgen del Puerto | Ermita de la Virgen del Puerto | Surface | Surface | Particiones | Particiones | Historia del Arte | Historia del Arte | Poliedros regulares | Poliedros regulares | Red 3D | Red 3D | Choisy | Choisy | Axonometric | Axonometric | Network | Network | Pattern | Pattern | Geom茅trico | Geom茅trico | Mosque | Mosque | Spatial | Spatial | Sinan | Sinan | Red | Red | 3D | 3D | Form | Form | Perspectiva | Perspectiva | Ordenador | Ordenador | Ismael Garcia Rios | Ismael Garcia Rios | Lacer铆a | Lacer铆a | Paraboloides | Paraboloides | Axonometr铆a | Axonometr铆a | Souto de Moura | Souto de Moura | Revolve | Revolve | Kingo Houses | Kingo Houses | Santa Mar铆a del Naranco | Santa Mar铆a del Naranco | Pedro de Ribera | Pedro de Ribera | Regular tessellations | Regular tessellations | Expresi贸n Gr谩fica Arquitect贸nica | Expresi贸n Gr谩fica Arquitect贸nica | Architecture | Architecture | Molina de Arag贸n | Molina de Arag贸n | Tessellations | Tessellations | Ponte de Lima | Ponte de Lima | Arabesco | Arabesco | compactaci贸n | compactaci贸n | Pantheon | Pantheon | Computer | Computer | Eduardo Torroja | Eduardo Torroja | Fern谩ndez del Amo | Fern谩ndez del Amo | Ribbed vault | Ribbed vault | Organic architecture | Organic architecture | Superficie cu谩drica | Superficie cu谩drica | Arquitectura | Arquitectura | Miguel Fisac | Miguel Fisac | Crecimiento org谩nico | Crecimiento org谩nico | Autocad | Autocad | Symmetrical polyhedra | Symmetrical polyhedra | Rhinoceros | Rhinoceros | Domical vault | Domical vault | Templete de los Evangelistas | Templete de los Evangelistas | Gr谩fica | Gr谩fica | Luigi Canina | Luigi Canina | MicroStation | MicroStation | Irregular tessellations | Irregular tessellations | Patio de los Evangelistas | Patio de los Evangelistas | Composici贸n Arquitect贸nica | Composici贸n Arquitect贸nica | Sabil | Sabil | Modelling | Modelling | quadric surface | quadric surface | Mesh | Mesh | Pante贸n | Pante贸n | Monasterio de El Escorial | Monasterio de El Escorial | Superficie | Superficie | Tunnel vault | Tunnel vault | Vegaviana | Vegaviana | Iglesia Santos Ap贸stoles | Iglesia Santos Ap贸stoles | Proyectos Arquitect贸nicos | Proyectos Arquitect贸nicos | Parab贸licos | Parab贸licos | Geometry | Geometry | Carmen Garcia Reig | Carmen Garcia Reig | Expression | Expression | Cuba hiperb贸lica | Cuba hiperb贸lica | Red espacial | Red espacial | Geometr铆a | Geometr铆a | skeletal polyhedra | skeletal polyhedra | B贸veda de rinc贸n de claustro | B贸veda de rinc贸n de claustro | S贸lido | S贸lido | Poliedros plat贸nicos | Poliedros plat贸nicos | Hiperb贸licos | Hiperb贸licos | Perspective | Perspective | Mimbar | Mimbar | Fedala | Fedala | Furniture | Furniture | Polygon | Polygon | Hyperbolic | Hyperbolic | B贸veda de arista | B贸veda de arista | Revoluci贸n | Revoluci贸n | C煤pula | C煤pula | B贸veda de ca帽贸n | B贸veda de ca帽贸n | Estructura | Estructura | Expresi贸n | Expresi贸n | Computer aided design | Computer aided design | Inform谩tica | Inform谩tica | Hollow faced polyhedra | Hollow faced polyhedra | Flexible | Flexible | Geometric | Geometric | CAD | CAD | Formas | Formas | B贸veda de crucer铆a | B贸veda de crucer铆a | Infograf铆a | Infograf铆a | Polyhedra | Polyhedra | Groin vault | Groin vault | Plane | Plane | Architectural | Architectural | Plano | Plano | Structure | Structure | Architectural drawing | Architectural drawing | Arquitect贸nica | Arquitect贸nica | Barrel vault | Barrel vault | Arabesque | Arabesque | Sombra | Sombra | Utzon | Utzon | Escher | Escher | Mueble | Mueble | Vault | Vault | Annular vault | Annular vault | Egipto | Egipto | Pol铆gono | Pol铆gono | Archimedean solids | Archimedean solids | Poliedros arquimedianos | Poliedros arquimedianos | Egypt | Egypt | Paraboloid | Paraboloid | Module | Module | Extrude | Extrude | Boolean | Boolean | Tuscan Order | Tuscan Order | Hyperboloid | Hyperboloid | Poliedros vacuus | Poliedros vacuus


Copyright 2009, by the Contributing Authors

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Readme file for Structured Systems Analysis


This readme file contains details of links to all the Readme file for Structured Systems Analysis module's material held on Jorum and information about the module as well.


ukoer | current logical data flow diagram example | current logical data flow diagram exercise | current logical data flow diagram teaching guide | current logical data flow diagram video lecture | current logical data flow diagram | current logical data flow diagrams example | current logical data flow diagrams exercise | current logical data flow diagrams teaching guide | current logical data flow diagrams video lecture | current logical data flow diagrams | current logical dfd example | current logical dfd exercise | current logical dfd teaching guide | current logical dfd video lecture | current logical dfd | current logical dfds example | current logical dfds exercise | current logical dfds lecture | current logical dfds teaching guide | data dictionary example | data dictionary exercise | data dictionary lecture | data dictionary reading material | data dictionary teaching guide | data dictionary video lecture | data dictionary | data example | data exercise | data flow diagram example | data flow diagram exercise | data flow diagram reading material | data flow diagram teaching guide | data flow diagram video lecture | data flow diagram | data flow diagrams example | data flow diagrams exercise | data flow diagrams reading material | data flow diagrams teaching guide | data flow diagrams video lecture | data flow diagrams | data reading material | data teaching guide | data video lecture | data | decision table and tree example | decision table and tree exercise | decision table and tree reading material | decision table and tree teaching guide | decision table and tree video lecture | decision table and tree | decision table example | decision table exercise | decision table reading material | decision table teaching guide | decision table video lecture | decision table | decision tables and trees example | decision tables and trees lecture | decision tables and trees reading material | decision tables example | decision tables exercise | decision tables reading material | decision tables teaching guide | decision tables video lecture | decision tables | decision tree example | decision tree exercise | decision tree reading material | decision tree teaching guide | decision tree video lecture | decision tree | decision trees and decision tables exercise | decision trees and decision tables teaching guide | decision trees and decision tables video lecture | decision trees and decision tables | decision trees example | decision trees exercise | decision trees reading material | decision trees teaching guide | decision trees video lecture | decision trees | dfd example | dfd exercise | dfd reading material | dfd teaching guide | dfd video lecture | dfd | dfds example | dfds exercise | dfds reading material | dfds teaching guide | dfds video lecture | dfds | exploding data flow diagrams example | exploding data flow diagrams exercise | exploding data flow diagrams reading material | exploding data flow diagrams teaching guide | exploding data flow diagrams | exploding dfd example | exploding dfd exercise | exploding dfd reading material | exploding dfd teaching guide | exploding dfd | logical data flow diagram example | logical data flow diagram exercise | logical data flow diagram reading material | logical data flow diagram teaching guide | logical data flow diagram video lecture | logical data flow diagram | logical data flow diagrams example | logical data flow diagrams exercise | logical data flow diagrams teaching guide | logical data flow diagrams video lecture | logical data flow diagrams | logical dfd example | logical dfd exercise | logical dfd reading material | logical dfd teaching guide | logical dfd video lecture | logical dfd | logical dfds example | logical dfds exercise | logical dfds reading material | logical dfds teaching guide | logical dfds video lecture | logical dfds | project management practical | project management reading material | project management task guide | project management teaching guide | project management | quality management | quality managment reading material | quality managment task guide | required logical data flow diagram example | required logical data flow diagram exercise | required logical data flow diagram reading material | required logical data flow diagram teaching guide | required logical data flow diagram video lecture | required logical data flow diagram | required logical data flow diagrams example | required logical data flow diagrams exercise | required logical data flow diagrams reading material | required logical data flow diagrams teaching guide | required logical data flow diagrams video lecture | required logical data flow diagrams | required logical dfd example | required logical dfd exercise | required logical dfd reading material | required logical dfd teaching guide | required logical dfd video lecture | required logical dfd | required logical dfds example | required logical dfds exercise | required logical dfds lecture | required logical dfds reading material | required logical dfds teaching guide | structured chart example | structured chart exercise | structured chart reading material | structured chart teaching guide | structured chart video lecture | structured chart | structured charts example | structured charts exercise | structured charts lecture | structured charts reading material | structured charts teaching guide | structured charts video lecture | structured charts | structured english example | structured english exercise | structured english lecture | structured english teaching guide | structured english video lecture | structured english | structured system analysis example | structured system analysis exercise | structured system analysis lecture | structured system analysis practical | structured system analysis reading material | structured system analysis task guide | structured system analysis teaching guide | structured system analysis video lecture | structured system analysis | structured systems analysis example | structured systems analysis exercise | structured systems analysis lecture | structured systems analysis practical | structured systems analysis reading material | structured systems analysis task guide | structured systems analysis teaching guide | structured systems analysis video lecture | structured systems analysis | structured walkthroughs reading material | system analysis example | system analysis exercise | system analysis lecture | system analysis practical | system analysis reading material | system analysis task guide | system analysis teaching guide | system analysis video lecture | system analysis | systems analysis example | systems analysis exercise | systems analysis lecture | systems analysis practical | systems analysis reading material | systems analysis task guide | systems analysis teaching guide | systems analysis video lecture | systems analysis | techniques in methods lecture | techniques in methods teaching guide | techniques in methods | uml | univeral modelling language lecture | univeral modelling language | universal modeling language lecture | universal modeling language | current logical dfds video lecture | current logical dfds | exploding dfds example | exploding dfds exercise | exploding dfds reading material | exploding dfds teaching guide | exploding dfds | levelling dfds example | levelling dfds exercise | levelling dfds reading material | levelling dfds teaching guide | levelling dfds | required logical dfds video lecture | required logical dfds | uml lecture | Computer science | I100


Attribution-Noncommercial-Share Alike 2.0 UK: England & Wales Attribution-Noncommercial-Share Alike 2.0 UK: England & Wales

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Institutional Processes in Developing Countries (MIT) Institutional Processes in Developing Countries (MIT)


This introductory course helps students learn to pose questions and analyze problems in the field of planning in developing countries. Not arguing for one "right" approach, the course draws on grounded empirical experiences - historical and recent - to help students navigate the way they approach their future work in developing-country governments, NGOs and international organizations. This introductory course helps students learn to pose questions and analyze problems in the field of planning in developing countries. Not arguing for one "right" approach, the course draws on grounded empirical experiences - historical and recent - to help students navigate the way they approach their future work in developing-country governments, NGOs and international organizations.


developing--country governments | developing--country governments | international | international | international organizations | international organizations | NGOs | NGOs | economies of scale | economies of scale | diseconomies of scale | diseconomies of scale | international development planning | international development planning | externality | externality | historical advances in developing and developing countries | historical advances in developing and developing countries | interaction between planners and institutions | interaction between planners and institutions | ecentralization | provision of low-cost housing | ecentralization | provision of low-cost housing | new--town development | new--town development | decentralization | decentralization | provision of low--cost housing | provision of low--cost housing | developing countries | developing countries | national planning | national planning | planners | planners | government institutions | government institutions | national government | national government | local government | local government | low-cost housing | low-cost housing | new-town development | new-town development | reform | reform | politics | politics | patronage | patronage | clientelism | clientelism | corruption | corruption | civil servants | civil servants | service-delivery organizations | service-delivery organizations | public vs. private | public vs. private


Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

馻randa, J. L.) La Acci髇 Administrativa en Sectores Espec韋icos 馻randa, J. L.) La Acci髇 Administrativa en Sectores Espec韋icos


En la asignatura "La Acci髇 Administrativa en Sectores Espec韋icos" se lleva a cabo una introducci髇 en los 醡bitos de referencia en los que se proyecta la acci髇 administrativa. El objetivo es ofrecer una visi髇 en vertical de las instituciones propias del Derecho administrativo que se estudian en horizontal en las asignaturas precedentes. En la asignatura "La Acci髇 Administrativa en Sectores Espec韋icos" se lleva a cabo una introducci髇 en los 醡bitos de referencia en los que se proyecta la acci髇 administrativa. El objetivo es ofrecer una visi髇 en vertical de las instituciones propias del Derecho administrativo que se estudian en horizontal en las asignaturas precedentes.


醤ica Fuerzas y Cuerpos de Seguridad | 醤ica Fuerzas y Cuerpos de Seguridad | 醤ica 2/1986 | 醤ica 2/1986 | Cuerpos y Fuerzas de Seguridad | Cuerpos y Fuerzas de Seguridad | Grado en Derecho | Grado en Derecho | 髇 de impacto ambiental | 髇 de impacto ambiental | 髇 de servicios | 髇 de servicios | | | Electricidad | Electricidad | Ley del Suelo | Ley del Suelo | 髇 de industrias | 髇 de industrias | 韘tico | 韘tico | 2014 | 2014 | 髇 de la econom韆 | 髇 de la econom韆 | Seguridad y calidad de la industria | Seguridad y calidad de la industria | 韆 administrativa | 韆 administrativa | 鷅lica | 鷅lica | 髇 responsable | 髇 responsable | Medio ambiente | Medio ambiente | 鷅lico del suelo | 鷅lico del suelo | 髇 urbana | 髇 urbana | 韘ticas | 韘ticas | Sectores en red | Sectores en red | 鷏timo recurso | 鷏timo recurso | Ley paraguas | Ley paraguas | 髇 p鷅lica | 髇 p鷅lica | 鷅lico | 鷅lico | 閏trica Espa駉la | 閏trica Espa駉la | Actividades clasificadas | Actividades clasificadas | 醤ica 1/1992 | 醤ica 1/1992 | Vigilantes de seguridad | Vigilantes de seguridad | Ley 54/1997 | Ley 54/1997 | Ley General de Telecomunicaciones | Ley General de Telecomunicaciones | Calidad industrial | Calidad industrial | Real Decreto Legislativo 2/2008 | Real Decreto Legislativo 2/2008 | Ley Omnibus | Ley Omnibus | Obligaciones de servicio publico | Obligaciones de servicio publico | Industria | Industria | Administraciones independientes | Administraciones independientes | 髇 ambiental | 髇 ambiental | Vivienda | Vivienda | Seguridad industrial | Seguridad industrial | Suelo no urbanizable | Suelo no urbanizable | 鷅licos | 鷅licos | 髇 urban韘tica | 髇 urban韘tica | Puertos | Puertos | Actividad de fomento | Actividad de fomento | 閏trico | 閏trico | Normas subsidiarias | Normas subsidiarias | Carreteras | Carreteras | 髇 financiera | 髇 financiera | Infraestructuras en red | Infraestructuras en red | 韆s urbanismo | 韆s urbanismo | | | 髇 del territorio | 髇 del territorio | Libre competencia | Libre competencia | 髇 medio ambiental | 髇 medio ambiental | 閟 general | 閟 general | 髇 econ髆ica | 髇 econ髆ica | Derecho Administrativo | Derecho Administrativo | Directiva de servicios | Directiva de servicios | Libertad de empresa | Libertad de empresa | 髇 del planeamiento | 髇 del planeamiento | Comunicaciones previas | Comunicaciones previas | Ley 25/2009 | Ley 25/2009 | Actividades de servicios | Actividades de servicios | Derecho de emisiones contaminantes | Derecho de emisiones contaminantes | 韘tica | 韘tica | 韆 Nacional | 韆 Nacional | Administraciones reguladoras | Administraciones reguladoras | Telecomunicaciones | Telecomunicaciones | 鷅licas | 鷅licas | Aeropuertos | Aeropuertos | 骻ica | 骻ica | Suelo urbano | Suelo urbano | Seguridad ciudadana | Seguridad ciudadana | Entes reguladores | Entes reguladores | 髇 del suelo | 髇 del suelo | Guardias de seguridad privada | Guardias de seguridad privada | Directiva Bolkestein | Directiva Bolkestein | Ley 17/2009 | Ley 17/2009 | Servicio universal | Servicio universal | Seguridad privada | Seguridad privada | Guardia Civil | Guardia Civil | Suelo urbanizable | Suelo urbanizable | Sectores regulados | Sectores regulados | 髇 de la Seguridad Ciudadana | 髇 de la Seguridad Ciudadana | Ley 32/2003 | Ley 32/2003 | Planes Especiales | Planes Especiales | Sistema europeo de bancos centrales | Sistema europeo de bancos centrales


Copyright 2015, UC3M

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Readme file for Object-Oriented Software Design


This readme file contains details of links to all the Object-Oriented Software Design module's material held on Jorum and information about the module as well.


ukoer | class design | queues | linked lists | object-oriented software design process | object oriented design process | java notes | java practical | java reading material | object-oriented design process reading material | object-oriented software design process lecture | object-oriented software design process reading material | array lecture | linked list lecture | queue lecture | design reading material | class design reading material | class design lecture | case study | classes lecture | objects lecture | gui lecture | software design pattern lecture | inheritance reading material | polymorphism reading material | inheritance lecture | polymorphism | java object serialization reading material | data file lecture | java | review of java | introduction to java | arrays | object-oriented design process | testing | java classes | java objects | inheritance | abstract classes | gui | software design | java object serialization | object-oriented software design | java class | java object | class testing | introduction to java reading material | introduction to java practical | introduction to java lecture | review of java reading material | review of java practical | review of java lecture | java lecture | object-oriented design process practical | object-oriented design process lecture | object oriented design process reading material | object oriented design process practical | object oriented design process lecture | object-oriented software design process practical | object oriented software design process reading material | object oriented software design process practical | object oriented software design process lecture | arrays reading material | arrays practical | arrays lecture | linked lists reading material | linked lists practical | linked lists lecture | queues reading material | queues practical | queues lecture | class design practical | testing reading material | testing practical | testing lecture | java classes reading material | java classes practical | java classes lecture | java objects reading material | java objects practical | java objects lecture | inheritance practical | abstract classes reading material | abstract classes practical | abstract classes lecture | gui reading material | gui practical | software design reading material | software design practical | software design lecture | polymorphism practical | polymorphism lecture | java object serialization lecture | object-oriented software design reading material | object-oriented software design practical | object-oriented software design lecture | object oriented software design lecture | java class reading material | java class practical | java class lecture | java object reading material | java object lecture | class testing reading material | class testing practical | class testing lecture | java object practical | g400 | oosd | g400 reading material | g400 practical | g400 lecture | oosd reading material | oosd practical | oosd lecture | Computer science | I100


Attribution-Noncommercial-Share Alike 2.0 UK: England & Wales Attribution-Noncommercial-Share Alike 2.0 UK: England & Wales

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

Readme file for Rapid Application Development


This readme file contains details of links to all the Rapid Application Development module's material held on Jorum and information about the module as well.


ukoer | access 2003 practical | access 2007 lecture | access 2007 practical | access 2007 task guide | access 2007 | access lecture | access practical | access reading material | action queries lecture | action queries practical | action queries task guide | action queries | action query lecture | action query practical | action query task guide | action query | lecture | practical | reading material | task guide | | class modules reading material | classes lecture | classes practical | classes reading material | classes task guide | classes | client server lecture | client server reading material | client server task guide | client server | data access practical | form data lecture | form data practical | form data task guide | form data | forms lecture | forms practical | forms task guide | forms | menus and toolbars lecture | menus and toolbars practical | menus and toolbars task guide | menus and toolbars | menus lecture | menus practical | menus task guide | menus | multitier architecture lecture | multitier architecture reading material | multitier architecture task guide | multitier architecture | multitier architectures lecture | multitier architectures reading material | multitier architectures task guide | multitier architectures | object concepts lecture | object concepts practical | object concepts reading material | object concepts task guide | object concepts | objects practical | objects task guide | queries lecture | rad lecture | rad methodologies reading material | rad methodology lecture | rad methodology practical | rad methodology reading material | rad methodology task guide | rad methodology | rad practical | rad reading material | rad task guide | rad | rapid application development lecture | rapid application development methodologies lecture | rapid application development methodologies practical | rapid application development methodologies reading material | rapid application development methodologies task guide | rapid application development methodologies | rapid application development methodology lecture | rapid application development methodology practical | rapid application development methodology reading material | rapid application development methodology task guide | rapid application development methodology | rapid application development practical | rapid application development reading material | rapid application development task guide | rapid application development | rapid application practical | rapid application task guide | recordset lecture | recordset practical | recordset task guide | recordset | recordsetclone lecture | recordsetclone practical | recordsetclone task guide | recordsetclone | recordsets lecture | recordsets practical | recordsets task guide | recordsets | recordsource practical | reports lecture | reports practical | reports task guide | reports | sql lecture | toolbars lecture | toolbars practical | toolbars task guide | toolbars | unbound recordsets practical | unbound recordsets task guide | user controls lecture | user controls practical | user controls reading material | user controls task guide | user controls | vba practical | vba lecture | vba reading material | vba task guide | vba | visual basic for applications lecture | visual basic for applications practical | visual basic for applications reading material | visual basic for applications task guide | visual basic for applications | visual basic lecture | visual basic practical | visual basic reading material | visual basic task guide | visual basic | web delivery task guide | .net lecture | .net practical | .net reading material | .net task guide | net | 4gl lecture | 4gl practical | 4gl task guide | 4gl | asp lecture | asp practical | asp reading material | asp task guide | asp | g400 lecture | g400 practical | g400 reading material | g400 task guide | g400 | rad methodologies lecture | rad methodologies practical | rad methodologies task guide | rad methodologies | practical report | Computer science | I100


Attribution-Noncommercial-Share Alike 2.0 UK: England & Wales Attribution-Noncommercial-Share Alike 2.0 UK: England & Wales

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

馻randa, J. L.) Organizaci髇 y Actividad de las Administraciones P鷅licas 馻randa, J. L.) Organizaci髇 y Actividad de las Administraciones P鷅licas


La asignatura Organizaci髇 y Actividad de las Administraciones P鷅licas pretende proporcionar una visi髇 de conjunto sobre la organizaci髇 de las Administraciones P鷅licas, estudiando la potestad organizativa que rige la Organizaci髇 General del Estado, as como las auton髆icas y locales. Adem醩, se estudiar la competencia de cada una de ellas, as como sus reg韒enes jur韉icos, los procedimientos y actos administrativos y el control sobre sus actuaciones. La asignatura Organizaci髇 y Actividad de las Administraciones P鷅licas pretende proporcionar una visi髇 de conjunto sobre la organizaci髇 de las Administraciones P鷅licas, estudiando la potestad organizativa que rige la Organizaci髇 General del Estado, as como las auton髆icas y locales. Adem醩, se estudiar la competencia de cada una de ellas, as como sus reg韒enes jur韉icos, los procedimientos y actos administrativos y el control sobre sus actuaciones.


Ayuntamientos | Ayuntamientos | | | Grado en Derecho | Grado en Derecho | 髇 de competencias | 髇 de competencias | 鷅licas | 鷅licas | Recurso de alzada | Recurso de alzada | 韆s de Estado | 韆s de Estado | 髇omos | 髇omos | Acto administrativo | Acto administrativo | Interesados | Interesados | 髇 administrativa | 髇 administrativa | Ejecutoriedad | Ejecutoriedad | Competencia administrativa | Competencia administrativa | Pleno | Pleno | Administraciones instrumentales | Administraciones instrumentales | Ley del Gobierno | Ley del Gobierno | Ministerios | Ministerios | Derecho Administrativo | Derecho Administrativo | 髇 Administraci髇 Local | 髇 Administraci髇 Local | Silencio negativo | Silencio negativo | 髇 p鷅lica | 髇 p鷅lica | 2015 | 2015 | Administraciones independientes | Administraciones independientes | Procedimiento administrativo | Procedimiento administrativo | 髇 de sentencias | 髇 de sentencias | 觬ganos administrativos | 觬ganos administrativos | Alegaciones | Alegaciones | Medidas cautelares | Medidas cautelares | Nulidad | Nulidad | Unidades administrativas | Unidades administrativas | 鷅licos | 鷅licos | Diputaciones Provinciales | Diputaciones Provinciales | LJCA | LJCA | Cabildos | Cabildos | Medidas provisionales | Medidas provisionales | 髇 de oficio | 髇 de oficio | Organigrama administrativo | Organigrama administrativo | Anulabilidad | Anulabilidad | Silencio positivo | Silencio positivo | Validez de los actos administrativos | Validez de los actos administrativos | LRJPAC | LRJPAC | 韆 local | 韆 local | LOFAGE | LOFAGE | Recursos administrativos | Recursos administrativos | 髇 contencioso-administrativa | 髇 contencioso-administrativa | 韉ico-p鷅lica | 韉ico-p鷅lica | 鷅licas empresariales | 鷅licas empresariales | Administraciones territoriales | Administraciones territoriales | Silencio administrativo | Silencio administrativo


Copyright 2015, UC3M

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

8.033 Relativity (MIT) 8.033 Relativity (MIT)


Relativity is normally taken by physics majors in their sophomore year. Topics include: Einstein's postulates; consequences for simultaneity, time dilation, length contraction, clock synchronization; Lorentz transformation; relativistic effects and paradoxes; Minkowski diagrams; invariants and four-vectors; momentum, energy and mass; and particle collisions. Also covered is: Relativity and electricity; Coulomb's law; and magnetic fields. Brief introduction to Newtonian cosmology. There is also an introduction to some concepts of General Relativity; principle of equivalence; the Schwarzchild metric; gravitational red shift, particle and light trajectories, geodesics, and Shapiro delay. Relativity is normally taken by physics majors in their sophomore year. Topics include: Einstein's postulates; consequences for simultaneity, time dilation, length contraction, clock synchronization; Lorentz transformation; relativistic effects and paradoxes; Minkowski diagrams; invariants and four-vectors; momentum, energy and mass; and particle collisions. Also covered is: Relativity and electricity; Coulomb's law; and magnetic fields. Brief introduction to Newtonian cosmology. There is also an introduction to some concepts of General Relativity; principle of equivalence; the Schwarzchild metric; gravitational red shift, particle and light trajectories, geodesics, and Shapiro delay.


Einstein's postulates | Einstein's postulates | consequences for simultaneity | time dilation | length contraction | clock synchronization | consequences for simultaneity | time dilation | length contraction | clock synchronization | Lorentz transformation | Lorentz transformation | relativistic effects and paradoxes | relativistic effects and paradoxes | Minkowski diagrams | Minkowski diagrams | invariants and four-vectors | invariants and four-vectors | momentum | energy and mass | momentum | energy and mass | particle collisions | particle collisions | Relativity and electricity | Relativity and electricity | Coulomb's law | Coulomb's law | magnetic fields | magnetic fields | Newtonian cosmology | Newtonian cosmology | General Relativity | General Relativity | principle of equivalence | principle of equivalence | the Schwarzchild metric | the Schwarzchild metric | gravitational red shift | particle and light trajectories | geodesics | Shapiro delay | gravitational red shift | particle and light trajectories | geodesics | Shapiro delay | gravitational red shift | gravitational red shift | particle trajectories | particle trajectories | light trajectories | light trajectories | invariants | invariants | four-vectors | four-vectors | momentum | momentum | energy | energy | mass | mass | relativistic effects | relativistic effects | paradoxes | paradoxes | electricity | electricity | time dilation | time dilation | length contraction | length contraction | clock synchronization | clock synchronization | Schwarzchild metric | Schwarzchild metric | geodesics | geodesics | Shaprio delay | Shaprio delay | relativistic kinematics | relativistic kinematics | relativistic dynamics | relativistic dynamics | electromagnetism | electromagnetism | hubble expansion | hubble expansion | universe | universe | equivalence principle | equivalence principle | curved space time | curved space time | Ether Theory | Ether Theory | constants | constants | speed of light | speed of light | c | c | graph | graph | pythagorem theorem | pythagorem theorem | triangle | triangle | arrows | arrows


Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

17.422 Field Seminar in International Political Economy (MIT) 17.422 Field Seminar in International Political Economy (MIT)


This field seminar in international political economy covers major theoretical, empirical, and policy perspectives. The basic orientation is disciplinary and comparative (over time and across countries, regions, firms), spanning issues relevant to both industrial and developing states. Special attention is given to challenges and dilemmas shaped by the macro-level consequences of micro-level behavior, and by micro-level adjustments to macro-level influences. This field seminar in international political economy covers major theoretical, empirical, and policy perspectives. The basic orientation is disciplinary and comparative (over time and across countries, regions, firms), spanning issues relevant to both industrial and developing states. Special attention is given to challenges and dilemmas shaped by the macro-level consequences of micro-level behavior, and by micro-level adjustments to macro-level influences.


international relations | international relations | political science | political science | economics | economics | wealth | wealth | neoclassical | neoclassical | development | development | ecology | ecology | power | power | trade | trade | capital | capital | foreign investment | foreign investment | intellectual property | intellectual property | migration | migration | foreignpolicy | foreignpolicy | globalization | globalization | internet | internet | sustainability | sustainability | institutions | institutions | foreign policy | foreign policy | IPE | IPE | dual national objectives | dual national objectives | global context | global context | pursuit of power | pursuit of power | pursuit of wealth | pursuit of wealth | international political economy | international political economy | neoclassical economics | neoclassical economics | development economics | development economics | ecological economics | ecological economics | lateral pressure | lateral pressure | perspectives | perspectives | structural views | structural views | power relations | power relations | politics | politics | international trade | international trade | capital flows | capital flows | intellectual property rights | intellectual property rights | international migration | international migration | foreign economic policy | foreign economic policy | international economic institutions | international economic institutions | theoretical perspectives | theoretical perspectives | empirical perspectives | empirical perspectives | policy perspectives | policy perspectives | disciplinary | disciplinary | comparative | comparative | time | time | countries | countries | regions | regions | firms | firms | industrial states | industrial states | developing states | developing states | macro-level consequences | macro-level consequences | micro-level behavior | micro-level behavior | micro-level adjustments | micro-level adjustments | macro-level influences | macro-level influences | complexity | complexity | localization | localization | technology | technology | knowledge economy | knowledge economy | finance | finance | global markets | global markets | political economy | political economy | e-commerce | e-commerce


Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

T茅cnicas de Investigaci贸n Operativa en Ingenier铆a T茅cnicas de Investigaci贸n Operativa en Ingenier铆a


El curso trata de mostrar una visi贸n amplia de las t茅cnicas que se recogen bajo la denominaci贸n de Investigaci贸n Operativa (IO), agrup谩ndolas en tres grandes bloques (m茅todos deterministas, m茅todos probabil铆sticos y otros m茅todos como simulaci贸n, toma de decisiones, participaci贸n p煤blica). Dentro de cada bloque se expone brevemente en qu茅 consiste cada m茅todo y se acompa帽a con ejemplos y ejercicios de aplicaci贸n. El curso trata de mostrar una visi贸n amplia de las t茅cnicas que se recogen bajo la denominaci贸n de Investigaci贸n Operativa (IO), agrup谩ndolas en tres grandes bloques (m茅todos deterministas, m茅todos probabil铆sticos y otros m茅todos como simulaci贸n, toma de decisiones, participaci贸n p煤blica). Dentro de cada bloque se expone brevemente en qu茅 consiste cada m茅todo y se acompa帽a con ejemplos y ejercicios de aplicaci贸n.


Precio sombra | Precio sombra | Programaci贸n entera | Programaci贸n entera | Algoritmos gen茅ticos | Algoritmos gen茅ticos | Grafos | Grafos | Procesos aleatorios | Procesos aleatorios | Subgrafo | Subgrafo | M茅todos heur铆sticos | M茅todos heur铆sticos | Matriz estoc谩stica | Matriz estoc谩stica | Funci贸n objetivo | Funci贸n objetivo | Recurrencia | Recurrencia | Rango de optimalidad | Rango de optimalidad | Problema de rutas | Problema de rutas | PERT | PERT | Informaci贸n | Informaci贸n | Restricciones | Restricciones | Simulaci贸n | Simulaci贸n | Comunidades de opini贸n | Comunidades de opini贸n | M茅todo Promethee | M茅todo Promethee | Funci贸n de energ铆a | Funci贸n de energ铆a | Combinatoria | Combinatoria | M茅todos de optimizaci贸n | M茅todos de optimizaci贸n | Coste fijo | Coste fijo | Teorema de Arrow | Teorema de Arrow | Programaci贸n din谩mica | Programaci贸n din谩mica | Monte ideal | Monte ideal | Muestreador de Gibbs | Muestreador de Gibbs | Minimax | Minimax | Riesgo | Riesgo | M茅todos de inteligencia artificial | M茅todos de inteligencia artificial | Problema de recubrimiento | Problema de recubrimiento | Estacionariedad | Estacionariedad | M茅todo Electre | M茅todo Electre | Redes | Redes | Grafo 谩rbol | Grafo 谩rbol | Modelos deterministas | Modelos deterministas | Forestal | Forestal | Gesti贸n | Gesti贸n | Camino m谩s corto | Camino m谩s corto | M茅todos determin铆sticos | M茅todos determin铆sticos | Soluci贸n 贸ptima | Soluci贸n 贸ptima | Simplex | Simplex | Problema de la mochila | Problema de la mochila | M茅todos estad铆sticos | M茅todos estad铆sticos | Conocimiento | Conocimiento | Funci贸n de valor | Funci贸n de valor | Asignaci贸n | Asignaci贸n | Protoagentes | Protoagentes | M茅todos meta-heur铆sticos | M茅todos meta-heur铆sticos | Indicadores | Indicadores | Multigrafo | Multigrafo | Investigaci贸n de operaciones | Investigaci贸n de operaciones | Matriz de adyacencia | Matriz de adyacencia | Flujo | Flujo | Algoritmo de Floyd-Warshall | Algoritmo de Floyd-Warshall | Optimizaci贸n | Optimizaci贸n | Regi贸n factible | Regi贸n factible | Mercado de trabajo | Mercado de trabajo | Tabu-search | Tabu-search | Sistemas complejos | Sistemas complejos | Utilidad | Utilidad | Multiatributo | Multiatributo | Simulated annealing | Simulated annealing | Bucle | Bucle | Algoritmos enumerativos | Algoritmos enumerativos | Probabilidad de transici贸n | Probabilidad de transici贸n | Tasa de transici贸n | Tasa de transici贸n | Modelos de decisi贸n | Modelos de decisi贸n | Cadena homog茅nea | Cadena homog茅nea | Espacio de estados | Espacio de estados | Tiempo de vida | Tiempo de vida | Colas | Colas | Sostenibilidad | Sostenibilidad | Organizaci贸n estrat茅gica | Organizaci贸n estrat茅gica | 脕rbol de decisi贸n | 脕rbol de decisi贸n | Decisiones colectivas | Decisiones colectivas | Preferencias | Preferencias | Maximin | Maximin | Diagrama de estados | Diagrama de estados | Problema de la diligencia | Problema de la diligencia | Modelos probabil铆sticos | Modelos probabil铆sticos | M茅todos de superclasificaci贸n | M茅todos de superclasificaci贸n | Problema de asignaci贸n | Problema de asignaci贸n | Nodos | Nodos | Funci贸n de supervivencia | Funci贸n de supervivencia | Ecuaciones de Chapman-Kolmogorov | Ecuaciones de Chapman-Kolmogorov | Formulaci贸n de funciones | Formulaci贸n de funciones | Grafo completo | Grafo completo | Valoraci贸n de alternativas | Valoraci贸n de alternativas | Riesgo de la decisi贸n | Riesgo de la decisi贸n | Curva de la ba帽era | Curva de la ba帽era | Distribuci贸n exponencial | Distribuci贸n exponencial | Programaci贸n no lineal | Programaci贸n no lineal | T茅cnicas de optimizaci贸n | T茅cnicas de optimizaci贸n | M茅todo GRASP | M茅todo GRASP | Algoritmo de Dijskstra | Algoritmo de Dijskstra | M茅todos monetarios | M茅todos monetarios | Proceso de Poisson | Proceso de Poisson | Suma de variables aleatorias | Suma de variables aleatorias | Control de proyectos | Control de proyectos | Problema de emparejamiento | Problema de emparejamiento | Procesos estoc谩sticos | Procesos estoc谩sticos | Problema de partici贸n | Problema de partici贸n | Estructuraci贸n jer谩rquica | Estructuraci贸n jer谩rquica | Problema de empaquetado | Problema de empaquetado | Toma de decisiones | Toma de decisiones | Investigaci贸n operativa | Investigaci贸n operativa | Grafo etiquetado | Grafo etiquetado | Fiabilidad | Fiabilidad | Tasa de fallos | Tasa de fallos | Markov | Markov | Problema del viajante | Problema del viajante | An谩lisis de sensibilidad | An谩lisis de sensibilidad | Programaci贸n lineal | Programaci贸n lineal | Multicriterio | Multicriterio | Problema del transporte | Problema del transporte


Copyright 2009, by the Contributing Authors

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

17.422 Field Seminar in International Political Economy (MIT) 17.422 Field Seminar in International Political Economy (MIT)


This field seminar in international political economy covers major theoretical, empirical, and policy perspectives. The basic orientation is disciplinary and comparative (over time and across countries, regions, firms), spanning issues relevant to both industrial and developing states. Special attention is given to challenges and dilemmas shaped by the macro-level consequences of micro-level behavior, and by micro-level adjustments to macro-level influences. This field seminar in international political economy covers major theoretical, empirical, and policy perspectives. The basic orientation is disciplinary and comparative (over time and across countries, regions, firms), spanning issues relevant to both industrial and developing states. Special attention is given to challenges and dilemmas shaped by the macro-level consequences of micro-level behavior, and by micro-level adjustments to macro-level influences.


international relations | international relations | political science | political science | economics | economics | wealth | wealth | neoclassical | neoclassical | development | development | ecology | ecology | power | power | trade | trade | capital | capital | foreign investment | foreign investment | intellectual property | intellectual property | migration | migration | foreignpolicy | foreignpolicy | globalization | globalization | internet | internet | sustainability | sustainability | institutions | institutions | foreign policy | foreign policy | IPE | IPE | dual national objectives | dual national objectives | global context | global context | pursuit of power | pursuit of power | pursuit of wealth | pursuit of wealth | international political economy | international political economy | neoclassical economics | neoclassical economics | development economics | development economics | ecological economics | ecological economics | lateral pressure | lateral pressure | perspectives | perspectives | structural views | structural views | power relations | power relations | politics | politics | international trade | international trade | capital flows | capital flows | intellectual property rights | intellectual property rights | international migration | international migration | foreign economic policy | foreign economic policy | international economic institutions | international economic institutions | theoretical perspectives | theoretical perspectives | empirical perspectives | empirical perspectives | policy perspectives | policy perspectives | disciplinary | disciplinary | comparative | comparative | time | time | countries | countries | regions | regions | firms | firms | industrial states | industrial states | developing states | developing states | macro-level consequences | macro-level consequences | micro-level behavior | micro-level behavior | micro-level adjustments | micro-level adjustments | macro-level influences | macro-level influences | complexity | complexity | localization | localization | technology | technology | knowledge economy | knowledge economy | finance | finance | global markets | global markets | political economy | political economy | e-commerce | e-commerce


Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

8.282J Introduction to Astronomy (MIT) 8.282J Introduction to Astronomy (MIT)


Introduction to Astronomy provides a quantitative introduction to the physics of the solar system, stars, the interstellar medium, the galaxy, and the universe, as determined from a variety of astronomical observations and models. Introduction to Astronomy provides a quantitative introduction to the physics of the solar system, stars, the interstellar medium, the galaxy, and the universe, as determined from a variety of astronomical observations and models.


solar system; stars; interstellar medium; the Galaxy; the Universe; planets; planet formation; star formation; stellar evolution; supernovae; compact objects; white dwarfs; neutron stars; black holes; plusars | binary X-ray sources; star clusters; globular and open clusters; interstellar medium | gas | dust | magnetic fields | cosmic rays; distance ladder; | solar system; stars; interstellar medium; the Galaxy; the Universe; planets; planet formation; star formation; stellar evolution; supernovae; compact objects; white dwarfs; neutron stars; black holes; plusars | binary X-ray sources; star clusters; globular and open clusters; interstellar medium | gas | dust | magnetic fields | cosmic rays; distance ladder; | solar system | solar system | stars | stars | interstellar medium | interstellar medium | the Galaxy | the Galaxy | the Universe | the Universe | planets | planets | planet formation | planet formation | star formation | star formation | stellar evolution | stellar evolution | supernovae | supernovae | compact objects | compact objects | white dwarfs | white dwarfs | neutron stars | neutron stars | black holes | black holes | plusars | binary X-ray sources | plusars | binary X-ray sources | star clusters | star clusters | globular and open clusters | globular and open clusters | interstellar medium | gas | dust | magnetic fields | cosmic rays | interstellar medium | gas | dust | magnetic fields | cosmic rays | distance ladder | distance ladder | galaxies | normal and active galaxies | jets | galaxies | normal and active galaxies | jets | gravitational lensing | gravitational lensing | large scaling structure | large scaling structure | Newtonian cosmology | dynamical expansion and thermal history of the Universe | Newtonian cosmology | dynamical expansion and thermal history of the Universe | cosmic microwave background radiation | cosmic microwave background radiation | big-bang nucleosynthesis | big-bang nucleosynthesis | pulsars | pulsars | binary X-ray sources | binary X-ray sources | gas | gas | dust | dust | magnetic fields | magnetic fields | cosmic rays | cosmic rays | galaxy | galaxy | universe | universe | astrophysics | astrophysics | Sun | Sun | supernova | supernova | globular clusters | globular clusters | open clusters | open clusters | jets | jets | Newtonian cosmology | Newtonian cosmology | dynamical expansion | dynamical expansion | thermal history | thermal history | normal galaxies | normal galaxies | active galaxies | active galaxies | Greek astronomy | Greek astronomy | physics | physics | Copernicus | Copernicus | Tycho | Tycho | Kepler | Kepler | Galileo | Galileo | classical mechanics | classical mechanics | circular orbits | circular orbits | full kepler orbit problem | full kepler orbit problem | electromagnetic radiation | electromagnetic radiation | matter | matter | telescopes | telescopes | detectors | detectors | 8.282 | 8.282 | 12.402 | 12.402 | plusars | plusars | galaxies | galaxies | normal and active galaxies | normal and active galaxies | dynamical expansion and thermal history of the Universe | dynamical expansion and thermal history of the Universe


Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

9.71 Functional MRI of High-Level Vision (MIT) 9.71 Functional MRI of High-Level Vision (MIT)


We are now at an unprecedented point in the field of neuroscience: We can watch the human brain in action as it sees, thinks, decides, reads, and remembers. Functional magnetic resonance imaging (fMRI) is the only method that enables us to monitor local neural activity in the normal human brain in a noninvasive fashion and with good spatial resolution. A large number of far-reaching and fundamental questions about the human mind and brain can now be answered using straightforward applications of this technology. This is particularly true in the area of high-level vision, the study of how we interpret and use visual information including object recognition, mental imagery, visual attention, perceptual awareness, visually guided action, and visual memory. The goals of this course are to help We are now at an unprecedented point in the field of neuroscience: We can watch the human brain in action as it sees, thinks, decides, reads, and remembers. Functional magnetic resonance imaging (fMRI) is the only method that enables us to monitor local neural activity in the normal human brain in a noninvasive fashion and with good spatial resolution. A large number of far-reaching and fundamental questions about the human mind and brain can now be answered using straightforward applications of this technology. This is particularly true in the area of high-level vision, the study of how we interpret and use visual information including object recognition, mental imagery, visual attention, perceptual awareness, visually guided action, and visual memory. The goals of this course are to help


functional magnetic resonance imaging (fMRI) | functional magnetic resonance imaging (fMRI) | neural activity | neural activity | human | human | brain | brain | noninvasive | noninvasive | resolution | resolution | high-level vision | high-level vision | object recognition | object recognition | visual attention | visual attention | perceptual awareness | perceptual awareness | visually guided action | visually guided action | visual memory | visual memory | voxelwise analysis | voxelwise analysis | conjugate mirroring | conjugate mirroring | interleaved stimulus presentation | interleaved stimulus presentation | magnetization following excitation | magnetization following excitation | active voxels | active voxels | scanner drift | scanner drift | trial sorting | trial sorting | collinear factors | collinear factors | different model factors | different model factors | mock scanner | mock scanner | scanner session | scanner session | visual stimulation task | visual stimulation task | hemoglobin signal | hemoglobin signal | labeling plane | labeling plane | nearby voxels | nearby voxels | shimming coils | shimming coils | bias field estimation | bias field estimation | conscious encoding | conscious encoding | spiral imaging | spiral imaging | functional resolution | functional resolution | hemodynamic activity | hemodynamic activity | direct cortical stimulation | direct cortical stimulation | physiological noise | physiological noise | refractory effects | refractory effects | independent statistical tests. | independent statistical tests.


Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata

International Relations (MIT) International Relations (MIT)


This graduate course is divided intothree parts. Together they are intended to provide theoretical, empirical, and policy perspectives on source and consequences of globalization, focusing on emergent structures and processes, and on the implications of flows of goods and services across national boundaries - with special attention to the issue of migration, on the assumption that people matter and matter a lot. An important concern addressed pertains to the dilemmas of international policies that are shaped by the macro-level consequences of micro-level behavior. This graduate course is divided intothree parts. Together they are intended to provide theoretical, empirical, and policy perspectives on source and consequences of globalization, focusing on emergent structures and processes, and on the implications of flows of goods and services across national boundaries - with special attention to the issue of migration, on the assumption that people matter and matter a lot. An important concern addressed pertains to the dilemmas of international policies that are shaped by the macro-level consequences of micro-level behavior.


globalization | globalization | migration | migration | international relations | international relations | political science | political science | environment | environment | public policy | public policy | transnational organization | transnational organization | sustainable development | sustainable development | global change | global change | government | government | technology | technology | security | security | civil society | civil society | political theory | political theory | theory | theory | policy | policy | emergent structures | emergent structures | processes | processes | flows | flows | goods | goods | services | services | national boundaries | national boundaries | international trade | international trade | immigration | immigration | international policies | international policies | macro-level | macro-level | micro-level behavior | micro-level behavior | policy dilemmas | policy dilemmas | comparative politics | comparative politics | integration | integration | national economies | national economies | IR | IR | IPE | IPE | sovereignty | sovereignty | inter-state relations | inter-state relations | supra-state | supra-state | non-state | non-state | narrow globalization | narrow globalization | comlex view | comlex view | international conflict | international conflict | domestic politics | domestic politics | international politics | international politics | population movements | population movements | macro-level behavior | macro-level behavior | complex view | complex view


Content within individual OCW courses is (c) by the individual authors unless otherwise noted. MIT OpenCourseWare materials are licensed by the Massachusetts Institute of Technology under a Creative Commons License (Attribution-NonCommercial-ShareAlike). For further information see

Site sourced from


Click to get HTML | Click to get attribution | Click to get URL

All metadata

See all metadata